Conserved Protein Domain Family
anch_rpt_ABC

?
TIGR03771: anch_rpt_ABC 
anchored repeat-type ABC transporter, ATP-binding subunit
This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 163483
View PSSM: TIGR03771
Aligned: 4 rows
Threshold Bit Score: 354.542
Threshold Setting Gi: 504073941
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002520239  27 ISASKGDLLALLGPNGAGKTTILRTMLGLVKPAKGTVKVAGASPGKGWRHIGYVPQRHEFAWDFPISVAGVVMSGRTRHI 106 Propionibacterium
WP_011905918  24 LRLDRGELVGLLGPNGAGKTTLLRAILALTAVRAGRVLVGGKPSRPGRCEIGYVPQRHEFTWDFPISVEQAVMSGRTGRM 103 Salinispora
WP_011274183  24 LEAHPGELIGLLGPNGAGKTTLMRSVLGLIPRTKGSIKAAS---------VGYVPQRHEFAWDYPIDVRHTVLNGRAGLI 94  Corynebacterium...
WP_014307935  25 FSVDAGEFLGLLGPNGAGKTTLMRAILGLIP-SQGNIHIDGR--------IGYVPQRHEFAWDYPIDVYHTVLNGRAGMI 95  Corynebacterium...
WP_002520239 107 GWLRRPCKDDHIAVRDALRTAGMAELANRTVGELSGGQRQRVLIARALATRPSVLLLDEPFTGVDMPTQEQLTELFIELS 186 Propionibacterium
WP_011905918 104 GLFRRPGVADWRAVGDALDRVQLTELRRRPVGELSGGQRQRVLVARALALAPRVLLLDEPFTGLDMPTQELLGDLFTSLA 183 Salinispora
WP_011274183  95 GPFRRSRRADFAATAHALKRVNLQHLADRPIGQLSGGQRQRVLVARALAVEPTLLLLDEPFTGMDFPSIESLVEILQALA 174 Corynebacterium...
WP_014307935  96 GWLRRPKVADFAAVDAALEQVRLTHLADRPIGELSGGQRQRVLVARALATKPQLLLFDEPFTGLDNPSTELLLGLFEELA 175 Corynebacterium...
WP_002520239 187 GAGTTLVMTTHDLAQAMATADRVCLVNRTVIADSTPQQLRDPAMWMQTFGISGSSPLLRIVGA 249 Propionibacterium
WP_011905918 184 GEEHAVLMTTHDLVAAVDTCSRLVLLNGRIIADGHPADLQDAALWTTTFGVSDTSPLLKLVKA 246 Salinispora
WP_011274183 175 ADGMSILMVTHDLAQAVHVCDRVVLLNGRVVADGAPDQLQNPEPWMETFDVRPDSPLLRGVGL 237 Corynebacterium jeikeium
WP_014307935 176 QAGNAIMMSTHNLPEAMAACHRVLLFNGEVVATGVPSQMLDAQPWKTTFRVEDGSPLLASLGI 238 Corynebacterium diphtheriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap