Conserved Protein Domain Family
anch_rpt_perm

?
TIGR03770: anch_rpt_perm 
anchored repeat-type ABC transporter, permease subunit
This protein family is the permease subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in the adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous permease subunits outside the scope of this family include manganese transporter MntB in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 163482
View PSSM: TIGR03770
Aligned: 5 rows
Threshold Bit Score: 327.889
Threshold Setting Gi: 499593448
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011274182   3 SFSQFLADLTNPALAFLPKALLVAVLSALVCGVIGTHVVLRGMAFIGDAVAHAVFPGLAIAFALQVSVIAGGAVAGAVVA 82  Corynebacterium...
WP_002536651   3 SPLDFLSDLTNPLLSFLPKALLVAVVCSVVAGVIGSHVVLRGMAFIGDAVAHSVFPGLAVAFLMQGSLLLGGSIAGLTTA 82  Propionibacterium
WP_018831693   2 SITDFLTDLFNPNLAFLPKALAIAVMSSIVCGVVGCYVVLRGMAFIGDAVAHAVFPGIAVAFVLQGSLVLGGAVAGVATA 81  Salinispora tro...
WP_011186746   4 NPIDFFTDLFHPGLAFLPKALAVAVISSTVCGIVGAHVVLRGMAFIGGAVSHAVFPGLAIAFVLSGDLVLGGVFAGVATA 83  Leifsonia xyli
WP_010934304   3 TPIEFFQDLGNPALAFLPKALLVAVLSSIVCGVVGTHVVLRGMAFIGDAVSHAVFPGLAVAFALQISVLAGGAVAGVIVA 82  Corynebacterium...
WP_011274182  83 LLIALFSQRRRVKEDTIIGIFFAAAFALGLVVISKVQGYTASLNSFLFGSITGVSNSDIIFSAVVGAVVILAVAALHKEI 162 Corynebacterium...
WP_002536651  83 ILVAVVSQNRRLKEDSVIGILFVGAFALGIVIISRAPGYSGSLQQFLFGSITGITDDDIVMVCVAGALVLALEWAVHKEL 162 Propionibacterium
WP_018831693  82 LLIAIFSQNRRVKEDSIIGVFLVGAFALGIVIISQAPGYAGSLQQFLFGSITGIADRDLYVVGGAGLVILGLVLALHKEF 161 Salinispora tro...
WP_011186746  84 VLVAVFSHNRRLNESSIIGVFFVVAFALGVVVISQTPGYAGSLEQFLFGSITGIPDRDLYVASITGVAVLGAMFLLHKEF 163 Leifsonia xyli
WP_010934304  83 ILIAAFSQRRRLKEDSIIGIFFAAAFALGLIIISRVEGYTASLTSFLFGSITGVPDSDVVIAAIVGSIIVLVLIVLTPQL 162 Corynebacterium...
WP_011274182 163 VAVSVDRETAAAMGIRVLLIDVILYLAVTAAVVMSVRTVGNILVLALLITPAAAARLWTDRLVVMMALSAVIGMVGSFLG 242 Corynebacterium...
WP_002536651 163 VTVGLDRETARASDLPVFALDLLLYVLVTMTVVISVQVIGNVLVLALLVTPAATARLLTDRLGQMMVLAPVIGGFSALVG 242 Propionibacterium
WP_018831693 162 VAVCLDREMSRSMGLSVFWLDIVLYVLVTLAVVISLQTIGTILVLALLITPAAAARLLTDRLGVMMLLAPVIGGSAAVVG 241 Salinispora tro...
WP_011186746 164 VTISLDRESARALGVPVFLLDLVLYVLVTLAVVISVQTIGNILVLALLVTPAATARMLTDRLGVMMSLSPVIGGLGTFIG 243 Leifsonia xyli
WP_010934304 163 VAVSLDRETARTMGMPVLLLDLVLYLAVTAAVVISIRTIGNILVLALLITPAATARMLTDKLSTMMWLSALVGAIGSILG 242 Corynebacterium...
WP_011274182 243 VYVSWAIDVPTGATIVLVLTVVFLLSFFVA 272 Corynebacterium jeikeium
WP_002536651 243 LYLSWSIDLPAGGTIVLVATAVFLACWLVA 272 Propionibacterium
WP_018831693 242 LYLSWSYDTPVGGTIVLIATAVFLAAWLLA 271 Salinispora tropica
WP_011186746 244 LYLSWSWDIPTGGTIVLVLTAAFLVAWFFS 273 Leifsonia xyli
WP_010934304 243 VYLSWALDYPTGATMVLVIFFIFLWSWMQS 272 Corynebacterium diphtheriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap