Conserved Protein Domain Family
RPA4764

?
TIGR03768: RPA4764 
metallophosphoesterase, RPA4764 family
This model describes a small collection of probable metallophosphoresterases, related to pfam00149. Members of this protein family usually have a Sec-independent TAT (twin-arginine translocation) signal sequence, N-terminal to the region represented by this model. This model and TIGR03767 divide a narrow clade of pfam00149-related enzymes.
Statistics
?
PSSM-Id: 163480
View PSSM: TIGR03768
Aligned: 5 rows
Threshold Bit Score: 791.014
Threshold Setting Gi: 500158881
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011160296  84 LGYGEWSYGSGLPIERRTDLMPAGYHKPADAARQRLVKFFSFSDVHITDKEAPNQLLLFQQTEPA-AASNTSVYSPVMLY 162 Rhodopseudomona...
WP_011439694  88 FGYGEWTLGSGLPIVTRTDLMRAGYEKPVGGESKRLIRFFAFTDVHITDKEAPNQLIGFQQTEPA-AVNNTSIYSPVMPY 166 Rhodopseudomona...
WP_011523707  33 ygygnytyggPLRIESRYDIMPDGYGLSKPARLKQFANFFATADVHMTDKETPNQIIYLQQEDPVyGAPGTSIYSPVMLY 112 Candidatus Kori...
WP_011472934  71 YGYGGWSFGAPLSYDKRLDLVAAGYQPASVYNAEKLLRFFTITDVHICDKESPSSAIYLGLKHGI-----SSGYSAVMLE 145 Rhodopseudomona...
WP_011833551  33 NGFGEWTYGDGVPLTVRDDIA---GGMNASGTGTELLSFATISDIHITDEESPLQVIALGYLRPF-----PSAYSPVSMY 104 Methanocorpuscu...
WP_011160296 163 STQVLDAAIQTVNDLHRRDRFDFGIALGDACNSTSYNELRWYIDVFDGKPIVPSSGAHRGADHIDFQMSFQAAGLDKDLP 242 Rhodopseudomona...
WP_011439694 167 TTQVLDAAVQTVNDLHSRDPFDFGIALGDACNSTSYNEVRWYIDVLDGQPITPSSGDHRGRDSVDFQMPFQAAGLAADLP 246 Rhodopseudomona...
WP_011523707 113 TTHVLDAAMQTVNALHKQAPFDFGICLGDVCNSSQYNELRWYIDVMDGKRITPSSGAHLGASTIDYQKPYKAAGLDPSIP 192 Candidatus Kori...
WP_011472934 146 STHVLDAAVQTINVLHRNDRFDFGISLGDVCNDTQYNELRWYIDVLDGKPITPSSGAHAGADTIGYQKPYQAAGLDKSIN 225 Rhodopseudomona...
WP_011833551 105 STQVLNAAVKTINNINKENKLDLVLSLGDAANNDQYNELRWYIDVLDGKTITPVSGGTAGKENIDYQQTFTAEGLD--MP 182 Methanocorpuscu...
WP_011160296 243 WYQVLGNHDHFMIGSFPVDGDPSLGFRESYTSDKVWAIGDVLRPNIATFPALFDDRNLRATPAFYPGVIDGASPYGAIIH 322 Rhodopseudomona...
WP_011439694 247 WYQVLGNHDHFMIGSFPVDADPTIGLRQSYTADRIWAVGDVLKPNREGFPALFDYRGLKATPAYYPGVIDGASPYGAIIH 326 Rhodopseudomona...
WP_011523707 193 WYQVLGNHDHFWLGSAAVDGDPTVDLRSAFIGSKVWAVGDLLVPNPEHFPCLHDTSASFKQPTFHMGVLDGSTPTGTIIG 272 Candidatus Kori...
WP_011472934 226 WYQALGNHDHFWMGTNPVSDY----IRQAFVGDEVLALGDI-----------FADPDGINHRDYYMGTLDGSTPYGDVVW 290 Rhodopseudomona...
WP_011833551 183 WYQTIGNHDEFFTGVFAMDEN----LSSVLVGDTVANLRLD-----------VTVTGDTSLTGYYMGVFNGSDPNGTIID 247 Methanocorpuscu...
WP_011160296 323 TGPTDDPAlnnQPPTVVADPGRRPLV----RAEWMAEFLDTATEPKGHGFGLIDraA-AGPDFACYSFMPKSDLPLKVIV 397 Rhodopseudomona...
WP_011439694 327 TGRADDPAfagKPPQIAADPGRRPLA----RAEWLAEFRNTTTRPKGHGFDLID--G-AGDGFACYSFVPKSNLPLKVIV 399 Rhodopseudomona...
WP_011523707 273 AGAAGSMN----PPAVVADANRRSLL----RAEWIQEFFNSTSSPVGHGFGLVD--GsLGSGFACYSFVPKSDIPLKVIV 342 Candidatus Kori...
WP_011472934 291 AGPVAEFP---APPKLVADPDRRSLL----RRQWMQEFFSTSSQPIGHGFSPAN----VEQDFACYSFHPNPAVPLKVIV 359 Rhodopseudomona...
WP_011833551 248 MGSVSSFA---SAPTVIADANRHAISddgvRIGFMQEFLNSSSLPYGHGYTEEM----IANDFACYSFDPVEGV--RIIM 318 Methanocorpuscu...
WP_011160296 398 LDDTRDEHD-------GSHDI--HGHGYLDAKRWEWLKAELARGQADNQLMIIANHIPIAVSPIGSEMEWWLGDATASPD 468 Rhodopseudomona...
WP_011439694 400 LDVTQSEQD-------GSRDI--HGHGFLDARRWDWLKAELARGQADDQLMIIANHIPIGVSPIGSEMEWWLGDANAAPD 470 Rhodopseudomona...
WP_011523707 343 LDDTQSEND-------GSHDI--HGHGFLDATRWTWLQKELAAGQAAHQLMIIAAHIPIAVAAIGSEFEWWESALDPNAA 413 Candidatus Kori...
WP_011472934 360 LDDTQNEHDanpphsaTSSPG--YGHGSLDKKRYDWLLKELADGQAAGELMIIAAHIPIGVEPPSSFVGWNSAA------ 431 Rhodopseudomona...
WP_011833551 319 LDDTTENGS-------TIGDIwaHGRGSLDEERFAWLKAELQKGQEDGVLMIIGAHIPIATMEEGAPSGWSLNS------ 385 Methanocorpuscu...
WP_011160296 469 YKNAVDLAGLVKTLHDTPNLLMWIAGHRHLNVVKAFPSPDPSRPERGFWQVETSSLRDFPQQFRTFEIYLNADDTVSVEA 548 Rhodopseudomona...
WP_011439694 471 FANAVDLAGLVTTLQAAPNLLMWIAGHRHLNVVKAFPSADPDRPEQGFWQVETCSLRDFPQQFRTFEIRLNADDTVSIEA 550 Rhodopseudomona...
WP_011523707 414 LQNAVSLTDMVAVLQNTPNLLLWISGHLHQNTVKAFMPPVGGVAESGFWEVEVSSLRDFPQQFRTFEIYLNSDYTVSIVT 493 Candidatus Kori...
WP_011472934 432 ---EVSEPQLIATLQQYPNLILLVAGHRHYNTVTAFKSPDPARPELGFWQVETASLRDFPQQFRLFDIVRNSDDTLSIFA 508 Rhodopseudomona...
WP_011833551 386 ---EVSQTELITELQKYPNLLMWVSGHNHMNTILPIASPDPAHPEYGFWVVETASLRDFPQEFRTFEITRYSDELVGIKT 462 Methanocorpuscu...
WP_011160296 549 VNVDVAPAEGTPAAQARKYAIAAQQIVGHDKQ 580 Rhodopseudomonas palustris
WP_011439694 551 MNVDIAVADGTPAAQSRKYAIATQQIIQNDLR 582 Rhodopseudomonas palustris
WP_011523707 494 TNVDPAVADGSPAAKSRMYAVATQQIIQPNQA 525 Candidatus Koribacter versatilis
WP_011472934 509 TDVDPAVKEGTPAAASRSHAVAALQIYASSKL 540 Rhodopseudomonas palustris
WP_011833551 463 VCVDVDVEGDPLAEKSRSYSIAAAQMSGKTDV 494 Methanocorpusculum labreanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap