Conserved Protein Domain Family
cyanoexo_CrtA

?
TIGR03763: cyanoexo_CrtA 
cyanoexosortase A
The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci and/or different taxonomic lineages. We designate this relatively divergent cyanobacterial type to be type 3. We propose the gene symbol xrtC. This type coexists with a TIGR02602-recognized form in Nostoc sp. PCC 7120. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 163475
View PSSM: TIGR03763
Aligned: 5 rows
Threshold Bit Score: 330.142
Threshold Setting Gi: 196204074
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDY03881       7 LGKPSYLLLAIATGITSIHFTLLEQSGNQNVISVSILIWLTAVSLVWDKRQEnnL-KLDSNLFATILGIILIAMALLRSV 85  Cyanothece sp. ...
EDU14462       7 LQKPNYWLLGLTAAIASLHLVILDQSSDQNLFSMSLLLWLAIASLLWDKRDQ--L-KLDSGILPTLVGIGLIALVLLRSI 83  Cyanothece sp. ...
EDZ93869      13 WKQSEFWLMAIAAGLMSIHLTLIYHRNNVSFLALSIMFWLSASSLVWEKIQE--LaKQTSSPWATLLGMLIIAIVLLKSA 90  Arthrospira max...
EDX98890      12 IKTSYFWLLTLATSLVVIYMTLLSKAGDTAHLGMSGLFLLVVGSLIWEKRHS--L-KLESHILSKLLGVLIIGLLLFKLP 88  Cyanothece sp. ...
WP_012162376  14 IKIPVMALLGVTGCFLALYFTANLRADKVAHLAMSLVFLFAALSSLWDRRLQ--L-QLGSNILSLGCGICMVGGILFQSL 90  Acaryochloris m...
EDY03881      86 -STSGY----HFFLAPWICAIGLVLLTAGFQGFRHYWQEISIFsLFLLYPALIhFLGMISMDKLTAMFSTFILWILGFQV 160 Cyanothece sp. ...
EDU14462      84 -SPSGY----QVYFSPFICGIALCLMASGVKQLHQYWKEILILgLFVLYPVFDkFLTAINLAKITAIFSTFFLWIAGYDV 158 Cyanothece sp. ...
EDZ93869      91 tRPTSN----WLGISPFISALGWTLIASGFSGFREYWRELTIL-FFLGVPKVF-IWPLVDISGITAKFAALILWYAGADV 164 Arthrospira max...
EDX98890      89 lSPHKTdlnpYLRISPFMFGLGLSLIASGVRGLKQYWRELIIL-FFLGIPSLI-LSSLTNPSEITAKFSAFILECLNYDV 166 Cyanothece sp. ...
WP_012162376  91 qSPTGW----YLAFAPFIAAIGVMLLASGWQTLGQYQIELLTL-FCLGLPKLL-LKFIPDISPFTAQFSTYLLWYSGFSV 164 Acaryochloris m...
EDY03881     161 YRDGVFIILPTGRVEVFYGCAGIDIVTLMIICSILLFFIVPLRNS-QKLFCLLLAPLIGFIVNSMRIGLLAFLVADANKE 239 Cyanothece sp. ...
EDU14462     159 HREGVFIALPTGKVEVLGGCAGIEIVILMFSTAVLFLLMFPQNYR-QKLICLIIAPAIGFIINAIRISILTLIVGYSDKE 237 Cyanothece sp. ...
EDZ93869     165 SLDKFNVMLPEGGVSVNMGCSGLEGMFYLLGLSVLFLVMFPLEVLwKKIIIPVVAVLISFVVNGFRIVLLAVLANAQKPE 244 Arthrospira max...
EDX98890     167 SLQGIHINLPTGGVTVVKGCSGLEAMAYLLGIAAIVLTLFPLRRI-YNLFVPIVAVIVGFVVNAVRVALMAILVASDQLD 245 Cyanothece sp. ...
WP_012162376 165 QLTNDLIQLPDGAVKVVPACSGLNLMTYMFAITVIFLLMFPLPTS-AKIMAPVVAVTLGFVINGIRVALLALLSTQNDPA 243 Acaryochloris m...
EDY03881     240 AFKYWHGEDGSLGFAMASVVLFGLFCWFSY 269 Cyanothece sp. PCC 8802
EDU14462     238 TFNYWHGDDGALVFSMMSVLLFGVFCWFFY 267 Cyanothece sp. PCC 7424
EDZ93869     245 AVDYWHVGEGSLIFSMISVALFGCFCWFMI 274 Arthrospira maxima CS-328
EDX98890     246 AFDYWHEGEGSLIFGMLAVVIFIGFYFLLI 275 Cyanothece sp. PCC 7822
WP_012162376 244 LFDYWHSNDGALVFVVVTVLLFGLFCGWIV 273 Acaryochloris marina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap