Conserved Protein Domain Family
ICE_TraI_Pfluor

?
TIGR03760: ICE_TraI_Pfluor 
integrating conjugative element relaxase, PFL_4751 family
Members of this protein family are the TraI putative relaxases required for transfer by a subclass of integrating conjugative elements (ICE) as found in Pseudomonas fluorescens Pf-5, and understood from study of two related ICE, SXT and R391. This model represents the N-terminal domain. Note that no homology is detected to the similarly named TraI relaxase of the F plasmid.
Statistics
?
PSSM-Id: 163472
View PSSM: TIGR03760
Aligned: 12 rows
Threshold Bit Score: 247.224
Threshold Setting Gi: 504657864
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011236061  59 PGWLQVLDASTLIQVCNLAGALQQIHRESKLSQAVWERDFAPAIGQTLRYVQLLPASEAHHHAHVGGLAAHTVEVVHAAI 138 Aromatoleum aro...
WP_011271866  40 EGWITPFSASELLNSELRQKYLNLLWQQVSMTQDMFNELYKKPIERYAEMVQLLPASESHHHSHLGGMLDHGLEVLSFAA 119 Haemophilus inf...
WP_011063008  21 QGFHLPVNAAALLNTPRRQELLENIWRRASLSHQQFNTLYRQPLERYAELVQLMPASENHHHAHLGGLLDHGLEIVAYAL 100 Pseudomonas pro...
WP_011334431  22 EGYLSIESAHTLLAVEHRRQLLDRIWQCTALSHVQFTQFYLNPIHRYAEQVQQLPASETHHHAYLGGMLDHGLELVACSL 101 Pseudomonas flu...
WP_005173659  34 NGYHAPVSAREQLATPRRRQCLQMLWDYSSLPNDMYQQYYLQPLEHCVTLMQQFPATESDHHAYLGGMVDHLLETVAYAA 113 Yersinia entero...
WP_023226837  34 DGYFNPAAISDLLQHERRQQWLRILWENSALPKERFERYFLLPLHGVVGLCQRLPASAQGKFAYTDGMVDYVIQTTVFAV 113 Salmonella ente...
WP_011145492  31 aGYFLPSESRLLLDTSRRRQYLQCLWDNSTLSKTRYQTLWLAPLHECVALMQQLPAAPQGPYARLGGLIDVTLQCTAFAV 110 Photorhabdus lu...
WP_023121121  26 KGSMRPESAASLLATPRRQKLLEHIWQRTSLSRRQFATLYLAPLERYAELVQQFPASENHHHAYPGGMLDHGLEIVAYAL 105 Pseudomonas aer...
WP_011817055  28 NGWFPFLNAESLLSVDNRKRALQQLWENSPFSRPVWEAFWLIPIRELAIRVQQLPAAQSGPYAREGGMLDKALDVAVCAV 107 Yersinia entero...
WP_011092232  29 lGYYLPLSVDALISLPKRQTFLQQLNDNHALPAAFYRQCYLTPLFSLLSRVQNLPASNEGNWAYAGAFGDLTVQFTAYAV 108 Pectobacterium ...
WP_011783532  19 PEYAVALSGKDLLKQPKRTELISRVKRLFSVTEQVWNKHYLYAIEQFAELVQEVPASEIHHHSESGGLIDHTLEALYAGV 98  Marinobacter hy...
WP_014844966  18 KDLIRMVTAEQFLSEEKRQVLLQKMRAFSGLEASRYESLCSVLVENLVNYCQNLPETANSYYSQPGGLVDHALNRTEAAL 97  Legionella pneu...
WP_011236061 139 AIRNGYLLPRGGAAEVVDRQRDHWTYAVIFAALLHDIGKPMTDLRVVLaerA----D--GPLr-pWLPMAGdmVAAGAae 211 Aromatoleum aro...
WP_011271866 120 KLRQSYVLPQNAAPEEQSKQRDAWTAAVIYAALVHDIGKVIVDIDIQL---K----D--GSR---WFPWLG--VPTQP-- 183 Haemophilus inf...
WP_011063008 101 KIRQTYLLPIGAPPESQSAQAEAWTTAAAYGALLHDLGKVAVDIRVEL---Q----G--GQI---WHPWHG--PIAKP-- 164 Pseudomonas pro...
WP_011334431 102 KLRQSYLLPTGAAPEDQAAQTDAWSAGIAYGALLHDIGKIAVDLLVER---Q----D--GRV---WHPWQG--SLDQP-- 165 Pseudomonas flu...
WP_005173659 114 RLSKNYLLPVGAQPEEQASQSAAWNSVIVYAAMLQSLDRL-CQIEVEL---Q----S--GQR---WIPLNF--LPGEP-- 176 Yersinia entero...
WP_023226837 114 RLSKGYMLPRGASAEEQSAQSVSWSAVVYYAALFHSLGRL-WNIEGEL---R----S--GAV---WRPGLS--VPEEP-- 176 Salmonella ente...
WP_011145492 111 RLAKGQMLPPGVAPETQAAQSVIWNTVVFYAALFHFLPVLA-KFEGEL---D----E--GQP---WYPGLA--VPQGA-- 173 Photorhabdus lu...
WP_023121121 106 KLRQSYLLPAGVTPEAQAAQAEAWTAGTAYAALLHDIGKIAVDLHVEH---A----D--GSV---WHPWHG--PLRKP-- 169 Pseudomonas aer...
WP_011817055 108 RLSRGWLLPPGAELEDQAIQSSAWNTAIFWAALLHDLGG-MDDIAAFH---Q----D--GTR---WYPGIA--PPNGP-- 170 Yersinia entero...
WP_011092232 109 RLAKGRTLPPGIPPEEQAAQGLLWNAVVFWSALFYHLPLL-CEWEGEL---D----G--GEC---WMPGFT--IPGKP-- 171 Pectobacterium ...
WP_011783532  99 RISQGYILPPNAEPESIAESADRWRFAAMIAILSHDLGKIVTDIEVVY---RlpekQ--FQI---WHPWYGniPPGAA-- 168 Marinobacter hy...
WP_014844966  98 SLFKEFTVQE--QPDLLSEEQKLWQYALYSAAILQGLGKLFDEFRINL---F----DsnGQLlkqWNPLLEslIQTGSy- 167 Legionella pneu...
WP_011236061 212 YEVRFapK-AERDYGAHRRL----PLVLAPRIVPATALAFLAREPSVMLELQAVWSGD-DATSVLTEIVRLADRRSAASN 285 Aromatoleum aro...
WP_011271866 184 YKFKY--I-KGRDYDLHPVM----GSFLANYLIPKEAFAWLAEYPEAFSALMYAMADHkDKAGLLSEIVQKADQNSVTLA 256 Haemophilus inf...
WP_011063008 165 YRFKY--I-KGREYQLHGAA----TALIYSQILAPEILDWLCGFPELWTELIYLVAGQfENAGILGEIVIKADSASVAQE 237 Pseudomonas pro...
WP_011334431 166 YRFRY--I-KGRDYHLHGAA----AGLLYTQILDRPILDWLSGFPPLWASLLYVLAGQyERAGVLGELVMQADRVSTAQN 238 Pseudomonas flu...
WP_005173659 177 YRFRF--T-PMADTVQVQSL----SAMLAWKIIPYEALIWLSTWPNVLKILSLYLTGFrHESGIVNTIVLDAIRVSAGSS 249 Yersinia entero...
WP_023226837 177 YRFRF--K-AEPDIAGAQVY----GELIALRFLPEPVLQWLGKNPDILRTLLAFISGRySDAMDITDIVNEAIVHAGGIP 249 Salmonella ente...
WP_011145492 174 YRFRF--KtSSVETMVACHF----GVLLAGRLLPAKALTWLASVPDALPSLFCILSGEmKKDNAINQIMTEALNKAGAPT 247 Photorhabdus lu...
WP_023121121 170 YRFRY--R-KEREYRLHSAA----TGLLYARLLDRDIFDWLSGYPDLWAALLYVLAGQyEHAGTLGELVVQADQASVAQE 242 Pseudomonas aer...
WP_011817055 171 WRFRF--CnSGPDT---PIL----GAIVGYRLLPEEGLRWLSHGPKVTNTLLVYLSGNqPDGDILHAAVNEARQKCGLQP 241 Yersinia entero...
WP_011092232 172 FRFRP--CiDKLPPSYAQGR----VSLLAGQLLPLSVLPWLSTIPDAFDCLAQRMQGRpATIALIDELLLSAAEKCGAPS 245 Pectobacterium ...
WP_011783532 169 YRYRFr-R-KIENTRLAKTLheksAMSLLPRLLSKEAATWLFKDLELISQLFSTISHStFGGQVIAEIVRAADGASVSKN 246 Marinobacter hy...
WP_014844966 168 YDYQF--E-KEADAELRRRL----NLLLARTLMPASGFAWIASNPEVLAVWLALLNEDyRSAGTLGAILIRADAIAIQRY 240 Legionella pneu...
WP_011236061 286 L 286 Aromatoleum aromaticum
WP_011271866 257 L 257 Haemophilus influenzae
WP_011063008 238 L 238 Pseudomonas protegens
WP_011334431 239 I 239 Pseudomonas fluorescens
WP_005173659 250 F 250 Yersinia enterocolitica
WP_023226837 250 L 250 Salmonella enterica
WP_011145492 248 I 248 Photorhabdus luminescens
WP_023121121 243 L 243 Pseudomonas aeruginosa
WP_011817055 242 L 242 Yersinia enterocolitica
WP_011092232 246 L 246 Pectobacterium atrosepticum
WP_011783532 247 V 247 Marinobacter hydrocarbonoclasticus
WP_014844966 241 F 241 Legionella pneumophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap