Conserved Protein Domain Family
conj_TIGR03758

?
TIGR03758: conj_TIGR03758 
integrating conjugative element protein, PFL_4701 family
Members of this family of small, hydrophobic proteins are found occasionally on plasmids such as the Pseudomonas putida TOL (toluene catabolic) plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 163470
View PSSM: TIGR03758
Aligned: 12 rows
Threshold Bit Score: 49.6664
Threshold Setting Gi: 499586244
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012105789  4 TGAQQSAWNAGvgGG-MEPSSLNFLILGLLGGVIFLFSAWTLVTAYRGVINKSLAMDKLPETAIRLIC 70  Yersinia pseudotuberculosis
WP_003050225  2 NGAQVSAFQAN--SG-IAPSAMATVLVGVVFAVLLVWGVWAIRTAYVGWSESRLNQRQFLGVCIRFVA 66  Proteobacteria
WP_011145430  2 NEVQRNAFRAA--SGnLDPHVMQFLCIGLLIAVLFLWAAWGMVDVWQGWANEKVREAAMNRFVIRVAL 67  Photorhabdus luminescens
WP_011633226  2 TSAQISAFQVN--SS-ITPAIMATVLVGFVFAVLLLWGAWAIRTAYVGWAESRINQRQFLGVVVRFLA 66  Nitrosomonas eutropha
KFX11970      2 TAAQSSAFKSA--SG-LDPQILSLICIGFLLASLFLWAAWALGDVWNGWANEKVRDAAMGRFALRTAI 66  Pectobacterium atrosepticum
WP_015899494  2 NSEQANAFKAG--SG-IDPTVLNKFVLGFVLSVLFLWFAWSVLVVFRGWRAGKVTEQNALHFFISTAI 66  Salmonella enterica
WP_014861274  2 TDAQLTAFSAV--AG-FTPQLSSVLWRSLVLVLALLWCTWVLWTGYRGWAAGNLNFGALGGSTLRLAL 66  Pseudomonas putida
WP_011330415  2 TAAQQTAFQAG--SG-ITPATMLTSIASMVLVLAFVWVIWVALGVFRAWQEGQATVFDLTWSTLRASI 66  Nitrosococcus oceani
WP_011062956  4 SSAQSAAFNAA--SG-ASAQASTNLIVGALMTVAMLWAAWALYSIYRGWATKNIDHSIASSSAIRVLL 68  Pseudomonas protegens
WP_011793689  4 SADQLAAFQAN--GG-FPASAVADVVLGFVFAVLLLWGVWAMRAAYAGWAEQRLSQRQFLAVVVRFLA 68  Acidovorax citrulli
WP_011267027  4 SSTQTSAFQAA--AG-FSPANSNTLWTGIAMGILLLWGVWVLLSIYRGWATRNLDRSAAAASAARWAV 68  Pseudomonas syringae
WP_011334413  4 TDAQTSAFQNA--SG-LSPQSSSTLWLSLVLVLALLWCAWVMWTAYRGWATGSVRFGAFGGSAARVLL 68  Pseudomonas fluorescens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap