Conserved Protein Domain Family
conj_TIGR03757

?
TIGR03757: conj_TIGR03757 
integrating conjugative element protein, PFL_4709 family
Members of this protein belong to extended genomic regions that appear to be spread by conjugative transfer. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 163469
View PSSM: TIGR03757
Aligned: 18 rows
Threshold Bit Score: 110.457
Threshold Setting Gi: 499555300
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005687600  23 NPIITVYSTQDYP-ILHAELA--SQVYLLDQVEQWENLISQRLSANPSVAAQQASQIFQSAEWKQSEEQLKRSYQGLISG 99  Haemophilus inf...
WP_011145437  19 FASTVIYTDTSHP-PLNADQN--VQVVYLDKPEQLQSQLFSKLSADPQQAVKQARQILQSPSWHQQERYISQAYQGLLNA 95  Photorhabdus lu...
WP_011092194  18 lANPVVYTDQQHP-PTNLTPE--TQIVWLDAPERLQRSVFGEFPASMEQATVQAQVVMRSPKWQQHENDLQTAYRGVVHA 94  Pectobacterium ...
WP_000821941  17 sAQIVVYTDQGHP-PVGVTPA--IRVVYLDASERWLQQQFGELSSDPEQAVRQAHSLLNSPDWKRRQKALIEHYRGMIEA 93  Salmonella ente...
WP_011609919  23 evNITVFSTQAYP-IQNAQLA--HRLYHLDSVEQWEEQLSQTLSANPAQAENQAKAFFQHPDSQTKIRELQQAYQGVILG 99  Histophilus somni
WP_003141524  29 QAETWVITDKAHP--VSATGS--SRVLFLDAQEHLEEQLTAALPQDPQHAQAAFKRLLQSPDGRRLQAELVKAQQDVADA 104 Pseudomonas aer...
WP_011062966  26 HAEAWVVTDSAHP--LIIPPGveIRVILLDDQERLENQLSRNLPPSPQQAAIAAQRMVKSPEGVRLMEELAKVQQGLTDV 103 Pseudomonas pro...
WP_011267009  30 NAETWIVTDRNHP--VQAPER--VRLILLDESERLEAKLSEGLPANQQQAIAIMQQRLKSSDARRLQRDLALAQQDLVDA 105 Pseudomonas syr...
WP_002813132  17 APAIEVFTDSTFQ-VVSASDN--TTVYVMDRINQLLQVLSEDLPSDPENAKQLVLARFQRMD-AQLSSELENAAKGLVQA 92  Nitrosococcus o...
WP_011795844  25 VTTVEVFANSATNlSTPSQPPyvLQVYRVDALAQLGRQFSARLPANEAQARAYMQQQEAQIR-ARYKDQITQAANGMSLA 103 Acidovorax
WP_005687600 100 WQNGIKKVPAVLFQypgkEDSVIYGETNIAQALSLWQREI 139 Haemophilus influenzae
WP_011145437  96 WTLGLKKFPAVVFD----DDYVVYGTTDVRQARLLWDTYQ 131 Photorhabdus luminescens
WP_011092194  95 WEIGVRKYPAVVFD----DRDVVYGTADVAMAIAYKMQEg 130 Pectobacterium atrosepticum
WP_000821941  94 WQLGLLKYPAVVFD----NRDVVYGTVDISRAVALRRGEN 129 Salmonella enterica
WP_011609919 100 WQMGIRKVPAVLFDspqlGQAVVYGVTDVQQAITFWEQWI 139 Histophilus somni
WP_003141524 105 WSLGVEKIPAVVVD----RQYVVYGEPDVSRALELIAKAR 140 Pseudomonas aeruginosa
WP_011062966 104 WSAGVEKIPAVVVD----RKYVVYGQPDVANALKVIERSR 139 Pseudomonas protegens
WP_011267009 106 WSMGVTKVPAVVVD----RKFVVYGETNATAAENRVAQWR 141 Pseudomonas syringae
WP_002813132  93 MQYGINRYPAIVIN----GNAVVYGVTDVSAATQLYQRWQ 128 Nitrosococcus oceani
WP_011795844 104 MHYRLTRLPAVVVN----REAVIYGVADVQHAVGLYQQSK 139 Acidovorax
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap