Conserved Protein Domain Family
conj_TIGR03749

?
TIGR03749: conj_TIGR03749 
integrating conjugative element protein, PFL_4704 family
Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in a region flanked by markers of conjugative transfer and/or transposition. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 163461
View PSSM: TIGR03749
Aligned: 22 rows
Threshold Bit Score: 272.645
Threshold Setting Gi: 500119843
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005769293  14 MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLP--RSLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQ 91  Pseudomonas syr...
WP_011609904  12 LCCAAIAWNAQAELLMKWQRLPLPIDLQVEKERVILVDKNVKVGYP--KALEGKIRLQSTGGAVYLKALEPFPTARLQLK 89  Histophilus somni
WP_010944868   9 GASLLLSNVASAEILLKWDRKPLPIELQVKEERIVFADKNVKVGYP--AQLEGKLRMQSSGGAVYFTALAEFPKSRLQLV 86  Haemophilus duc...
WP_011271846  10 AAFIFSPMTASADVLMKWARKPLPIDLQIEKERILFVDKNVKVGYP--PELDSKLRIQSTGGAVYLKATADFPKTRLQLM 87  Haemophilus inf...
WP_011145433  17 faglVMVSPVEAVELMKWERIPLPVALHVGQERVVFVDKNVRVGFP--GALDGKLRIQSTGGAVYLYPSETFTQTRLQLQ 94  Photorhabdus lu...
WP_011092187  18 AFLMTVSWHAAADELIKWERIPLQIPLKVGQERVIFADKNVRVGFP--PALNDKLRVQSTGGAVYLKADSAFPQTRLQLQ 95  Pectobacterium ...
WP_011817084   9 vvfmmmpvvvSAVELMKWERIPLQIPLNVGQERIVFVDKNVRVGFP--PTLNGKLRVQSSGGAVYLSASETFPVTRLQLQ 86  Yersinia entero...
WP_011783552   9 VAFLCVATSSWAEQIIHYDNLPVTIELHNGEERSIQFGSHVQVGITkgQQVKKLFRAQSAQGAVHFLPYEAFDKQRVQIR 88  Marinobacter hy...
WP_002813318  29 sFAQVDDAASNSPERIVWNKAPIAIPLVVSEERLVHFPDSVSIGLP--QSLTPFLRSQSINGTLYLLARQPFETTRVMVR 106 Nitrosococcus o...
WP_011946087  12 GFMLTQVSYALQSEHLVWEKVPLTIELPINKERLVQFPQAIKI-ID--QQLSTNLDILKVKGSLYLNAKDTFNDARLIVQ 88  Legionella pneu...
WP_005769293  92 NAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGA------ATARSAkattksmdstsrsndedDEPEE---- 161 Pseudomonas syr...
WP_011609904  90 DMLTNEIILLDITAKEKVDNPQ--ETVRLLYEGKLENQSGSL------NQDEEV-----------------TEEVA---- 140 Histophilus somni
WP_010944868  87 DLATGELILLDVEAKPHIPNAN--EPIRLVYTDKVEKQSTVF------NQD--S-----------------GEEAD---- 135 Haemophilus duc...
WP_011271846  88 DVATGEIILLDVQAKHSVANAS--EPIRFVYENKVEKQTTAY------GQDANA-----------------YNEPM---- 138 Haemophilus inf...
WP_011145433  95 DVESGEVILLDVTAT---NGKDPLEPVRVVYHGDVITLTDDHqihhgaKGDNTS-----------------ATSPSlage 154 Photorhabdus lu...
WP_011092187  96 DLESGEIILLDVTA--SLNGPT--EPIRLVYSGDVTTVDNSD------RPAKSSersssss---asetkldAKAPK---- 158 Pectobacterium ...
WP_011817084  87 NKANGEIILLDVSAT---AGKSIREPVQLVYDGEVSSASTSDktrisgNEQTAA-----------------ISERR---- 142 Yersinia entero...
WP_011783552  89 RMDDGKVILLDLIATDKADGEKSLEDVRIVLASDNVV-----------SSDDAA-----------------ASMPE---- 136 Marinobacter hy...
WP_002813318 107 SETDGPIYVLDISASPSGSDSRSLPDVRILLESPQDA-----------GAAEST-----------------SDNRS---- 154 Nitrosococcus o...
WP_011946087  89 LLPEGEVIILNLKANEKVVNTT---PIEILIDDPKAT-------------HQSG-----------------ASQYE---- 131 Legionella pneu...
WP_005769293 162 -------VVK--RETPVPVVL-TRYAAQMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVK--STPLGAWRLDDFWV 229 Pseudomonas syr...
WP_011609904 141 -------SAS--VQLPVPAAL-TRYAAQMLYAPLRTVEPVLGIRQIAHGLPSKITTLLPAYPIT--ATPLMSWQLGDYVV 208 Histophilus somni
WP_010944868 136 -------LKNvkPQLPVPAAL-TRYAAQMFYAPLRTVEPLEGVRQVAHRLPNKITTLLPAYPIQ--ATPLLSWQLENFVV 205 Haemophilus duc...
WP_011271846 139 -------PNA--RPALPAPAAlTRYAAQMFYAPLRSVEPLEGVRQVSHRLPTPLKTLLPALPVR--ATPLLSWQLDEYVV 207 Haemophilus inf...
WP_011145433 155 rqaarrqKPS--YTAPLPVVL-TRYAAQSLYAPLRTVEAVPGIHPVSLALSPRLTTLYPSAPVI--VSPLGGWGVDNLTV 229 Photorhabdus lu...
WP_011092187 159 -------TPR--YNAPLPVVL-TRFAAQTLYGPLRAVEPVSGIHPVNPRISGKITTLYPSEPFD--ITTLSAWGVGARSV 226 Pectobacterium ...
WP_011817084 143 -------KPAk-LNTPLPVVL-TRYAAQSLYGPLRTVEPVVGITNTALKLPSRLTTLYPSEPVE--VSPLVGWSLNGYSV 211 Yersinia entero...
WP_011783552 137 -------KV----ELITPIDL-TRYAAQRLYGPTRLHHDQAGISETPLAVKGAVRIFKGPARYKtlSKPVVAYQGGGYYL 204 Marinobacter hy...
WP_002813318 155 -------LSL------GYATL-TRYAAQQLYAPTRLIPHQSGV--VAMPVNAEPVDLVHGAKVE--AVPVAAWKVGLKYV 216 Nitrosococcus o...
WP_011946087 132 -------YNA--------IQL-TRFAIQALYSPERVRDIPEGIYRSPMQTNKTIP-LFYGASIE--AHPLASWRGGSLYV 192 Legionella pneu...
WP_005769293 230 TAVKLQNQTAQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQA 287 Pseudomonas syringae group
WP_011609904 209 TAIRLQNQGTSRITLDPRELQGRFYAATFQHHWLSGLGSTEDTTTLYLVTEGRPnqai 266 Histophilus somni
WP_010944868 206 TAIRLQNRGSSHIELDPRELQGRFYAATFQHGWLGGHGSPEDTTTLYLVTEGYA-NQA 262 Haemophilus ducreyi
WP_011271846 208 TAVRLQNQGQSRIDLDPRELQGRFYAATFQHNWLGGHDTPEDTTTLYLVTEGSPnhsv 265 Haemophilus influenzae
WP_011145433 230 VALKVRNTHRENVVLDPRRLQGQFIAATFQHRWLGPSGTPEDTTTVYLVVKGRPdraf 287 Photorhabdus luminescens
WP_011092187 227 VALRIRNTSSRKVVLDPRILQGQFVSATFQHRWVGPIGTPEDTTTLYLVTDSRPelaf 284 Pectobacterium atrosepticum
WP_011817084 212 IALLVRNTATVNVILNPRMLQGEFISAAFQHPWLGSAGMPEDTTVLYLVVRGRPegaf 269 Yersinia enterocolitica
WP_011783552 205 AALYIRNVSDETVQLDYLDLNLPFSHATLQHHSLEPQGTPGDSTVLYLISE-RSLKET 261 Marinobacter hydrocarbonoclasticus
WP_002813318 217 TAVKLTNRTQRPLVLDPRELRGSWLAATFQHNRLLPAGNAADTTAVYLVSD-RPFDVA 273 Nitrosococcus oceani
WP_011946087 193 TVVDLKNLLNQPVKLQFSKLMGRWQTASFYPKGELPPRNQHESTTVFLVSD-QPFATA 249 Legionella pneumophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap