Conserved Protein Domain Family

TIGR03748: conj_PilL 
conjugative transfer region protein, TIGR03748 family
This model describes the conserved N-terminal region of a variable length protein family associated with laterally transfered regions flanked by markers of conjugative plasmid integration and/or transposition. Most members of the family have the lipoprotein signal peptide motif. A member of the family from a pathogenicity island in Salmonella enterica serovar Dublin strain was designated PilL for nomenclature consistency with a neighboring gene for the pilin structural protein PilS. However, the species distribution of this protein family tracks much better with markers of conjugal transfer than with markers of PilS-like pilin structure. [Mobile and extrachromosomal element functions, Plasmid functions]
PSSM-Id: 163460
Aligned: 19 rows
Threshold Bit Score: 139.326
Threshold Setting Gi: 499249197
Created: 9-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011271838 142 KVHYQFGPMALRDALQMLAGPAYEITINDVSRTVCF 177 Haemophilus influenzae
KFX11943     122 GVQRNIGPVRLSEALQIVAGPAWRLRVDDVNREICF 157 Pectobacterium atrosepticum
WP_012105813 125 GVQRSMGPLRLSDALQILAGPAWRLLVDDVNREVCF 160 Yersinia pseudotuberculosis
WP_011145407 124 AIQRKMGPIRLSEALQIVVGPAWRIRVDEVNREVCF 159 Photorhabdus luminescens
WP_015463246  92 AAHVHLGPTTLLTALLAMSGNAWILDVDEAHREVCF 127 Xanthomonas axonopodis
WP_011783540 103 AIHRKIGPMTLDKALTTLSGEAFELVVDPVHRKVAF 138 Marinobacter hydrocarbonoclasticus
WP_011330410 113 AVHRRFEPMPLQTVMGLMIGPAFHLIQDPVHRLIAF 148 Nitrosococcus oceani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap