Conserved Protein Domain Family
conj_TIGR03747

?
TIGR03747: conj_TIGR03747 
integrating conjugative element membrane protein, PFL_4697 family
Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 163459
View PSSM: TIGR03747
Aligned: 18 rows
Threshold Bit Score: 233.329
Threshold Setting Gi: 506459609
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011145427  15 KSGPLKTvL-WDMPWMLIGFLLVSLFFSLVIEYLGIAFFWPEQGERHSQQVMITESGWLSKEFTRSLLLSEPATT-LSIG 92  Photorhabdus lu...
WP_011334410  15 RPGLIIS-T-ISLVLRVIGLLIASLLFSILIEFAGLLLFWGDQGWLHSQAMLTSELGWLSEHFKSSLLIQQPGPT-IVQW 91  Pseudomonas flu...
WP_010944873  10 KKGPC------HYINALFAALFISLFLSIIFEWLGIAFIWTDEGHLHSQQMMIKELGWLSEDLTQGIASRSPKEL-AEEL 82  Haemophilus duc...
WP_011817090  17 KPGLFMS-LfWHLPWTIIGILLASWLVSLLIEYIGMIFFWASEGAEHSKQVMFTERAYLSEGFTRSLLMSEPATL-ISYW 94  Yersinia entero...
WP_005687582  10 KKGLFY------YINAVLAALLGSLILSIILEWLGIAFLWPEEGHLHSQKMMLTELGWLSDSLTRGLFYHSPKEL-AEGL 82  Haemophilus
WP_011783546  12 RRGPIGK-T-IELVLKIIGLLLFSAFMSVVIEWVGMAFFYDEPGYAHAESMMQTEIGYLSESLTGGDGMNEGAISsASET 89  Marinobacter hy...
WP_010989289  17 PPGLLTLvL-WIWPVRLLAFLLVSWMAGVFIEWAGMFFFWSDQGALHSQSVMNKELGYLSADFTQSLIFSSPSVT-TMGW 94  Salmonella ente...
WP_012052652  14 sSGLIFG-T-LELCLRLLGLLLASLIFSIALEFVGMLWFWPEQGWHHSHAMWLSELGWLSNHFKNSLLVQEPAQA-TAKI 90  Pseudomonas put...
WP_011609896   5 tnqkvkkkgllytlsallatlflslllsillewlGIAFIWSEQGHLHSQAMMIQELGWISESTTRSLFGYSPSEL-ANTI 83  Histophilus somni
WP_011092179  16 PHGLLYHvL-WGWPWKLIGIVLGSLLLSLLIEYVGIAFFWPTEGAAHSQQVMNTELGYLSSEFKRSLLFSEPSVT-VIHW 93  Pectobacterium ...
WP_011145427  93 LKWSYQWVFVDSGALDWINQQHTVQARSHY--EmvRELSDWSVLLAESLRKYLLATVYVTVTFIIRLTILVLSLPLFVMV 170 Photorhabdus lu...
WP_011334410  92 LDLLNQWLLVKTGFADFAQQARVSSM------G--NSFWGWINQFYVSIEDFVLAAVYVTFTFMVRLTILVLATPLFLLA 163 Pseudomonas flu...
WP_010944873  83 ILTLNHWLFVKTGLRGWLDNPAQ--------------HNSWELWIYHYARAYIESVIYVSITFVIRLIVIVFSSPLFLLA 148 Haemophilus duc...
WP_011817090  95 IQQAYQWLFVDSGFIRWINDGRQVKTQEGA--L--QSLNLFGSWLARVLWEYLQATVYVTVIFFIRVAILVLSIPLFIMV 170 Yersinia entero...
WP_005687582  83 ILSLHEWLFVKTGVKDWLANPRE--------------HSGVGLWVYHYGRAYIESVIYVFITFVIRLVVIVFTSPLFLLA 148 Haemophilus
WP_011783546  90 VSTVANFLFIDSGIVDNLQAVKTVSPDDGE-------IKAAVKRLVAGYYDYLMAAVYVLIMFLVRMAILFLSMPAFILF 162 Marinobacter hy...
WP_010989289  95 ISSAYQWAFVDSGLLTWIQKEQRETLSSSD--SvvFFLGQVQAWLLSVLSDYLLALVYVTVVFAVRVLILVLSIPLFVLV 172 Salmonella ente...
WP_012052652  91 LEHLNDWAAVRSGWAQSDTQLKLLS----R--E--ASFQGKFAQVYVVIQDYLLAALFTVFTFVVRLAVLTLAMPLFLLA 162 Pseudomonas put...
WP_011609896  84 TLTLHDWLFVKTGFQPWLHSPSK--------------HSDWEYLIYHYTRAYLESIIYVLITFVVRLIVIIFTSPLFLLA 149 Histophilus somni
WP_011092179  94 INTGYHWAFINSGFMDWVSNQYQMQAKSHSelG--RSLNAWSGWLAQSLREYLLATVYVTVVTLVRVTILFLSIPLFAMV 171 Pectobacterium ...
WP_011145427 171 IGVAVVEGLNRRDLRRYGAAYESSFVYHHAKRFVKPAFCVPCLLYLSWPSAVYPNLLLLPAAILLGVAITVMMSTFKKYL 250 Photorhabdus lu...
WP_011334410 164 SLTGFIDGLMRRDLRKFGAGRESSFVYHRAKRAVIPLLIVPWIIYLSLPFSLNPMVVFLPCAVMLGITVAITASTFKKYL 243 Pseudomonas flu...
WP_010944873 149 AFAGLTEGMMMRDLRKFGAGRESSFVYHHARRLIGPVMIGAWIFYLSIPVSIYPNLVLMPAAFLFGLSICVTFASFKKYL 228 Haemophilus duc...
WP_011817090 171 CANGVVDGLVRRDLRRYGAGYESSFIYHHAKRFVKPAMVGPCMLYLSWPTAVWPNLLLLPAAVALGMMVSVVVGAFKKYL 250 Yersinia entero...
WP_005687582 149 AFAGFTEGLMMRDRRKFGAGRESSFLYHHARRLIGPIMLSAWVLYLSIPISIYPNIILVPAAFLFGLSICVTAASFKKYL 228 Haemophilus
WP_011783546 163 GIVGISDGLMQRDLRRWCGGNESGYVYHWAKRFSLPVLALAWILYLSIPNSIHPNFIITPFAVLFGLCLMVMTSKFKKYL 242 Marinobacter hy...
WP_010989289 173 IIVAVIDGLCRRDLRRYGAGYESSFLYHHAKRFVKPAVYLPCLLYLSWPASIYPNLLLLPGALLLGLAVTVVTSTFKKYL 252 Salmonella ente...
WP_012052652 163 VVTGAVDGLMRRDLRKFGAGRESSFVYHRAKRTLLPLMVSPWVIYLSLPLTVNPIWVLLPCAAVLGWMVAVTAATFKKYL 242 Pseudomonas put...
WP_011609896 150 AFAGFTEGLMIRDLRKFGSGRESSFLYHHARRYIKPVMIGSWILYLSIPVSVYPNIILIPAAFLFGLSICITVASFKKYL 229 Histophilus somni
WP_011092179 172 VIVAIVEGLGRRDLRRFGAGYESSFLYHHAKRLVKPAFYVPAMLYLSWPMAVYPNLLLLPAALLFGTAITVTTATFKKYL 251 Pectobacterium ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap