Conserved Protein Domain Family
conj_TIGR03746

?
TIGR03746: conj_TIGR03746 
integrating conjugative element protein, PFL_4703 family
Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. The function is unknown. [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 163458
View PSSM: TIGR03746
Aligned: 15 rows
Threshold Bit Score: 311.947
Threshold Setting Gi: 500107546
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011805410   4 FKNEVAHLQAHVKTL-RLGAGALFVVALLLGFGWWSAPKSLTIHVPPDLRSGSTRK---WWD----VPPESVYAFSFYIW 75  Proteobacteria
WP_012105786   4 FRHAVSARDNHISSL-RLFCIMFFIGMVASSIGWMRAPDELTIHNPPDLRSGSTKK---WWE----VPPSTVYSFAFYIF 75  Yersinia pseudo...
WP_000086082   4 FRHALKDRDQHILTL-RLACGVLLLLLILVITGWMRAPSDLTIHNPPDLRSGSTRK---WWE----VPPSTVYSFAFYIF 75  Salmonella ente...
KEA11436       3 FRKHTAQQQAHINTF-RFITGFLCMVIVVLAYCVWEARKDLWIHIPPDLRSGSTRL---WWD----IPPESVYAFGLYIF 74  Pseudomonas aer...
WP_011092186   4 YRNAVRNRDQHILTL-RIACGVLVVLLLVTILGWMRAPSNLTVHNPPDLRAGSTKP---WWE----VPAPTVYSFAFYIF 75  Pectobacterium ...
WP_011334416   4 FRNKVDAQQAHIVSL-RLAVVILALLCAGLWYGWRSAPTDLTVHVPPDLRSGSTRK---WWD----IPSENVYAFALYIF 75  Pseudomonas flu...
WP_011609903   4 LKSELNHKDRQLTVA-KIAIVCITIICFALMFIIYTFPSTLKILLPPDLRAGSQRP---WWE----VPPSTVYAFAYQTF 75  Histophilus somni
WP_002813822   4 YRLEIDNVRSHLRSL-WVVIGLQGLIILALWIGWSQAPKQLRVYVPPDLRSGAVLA---AEE----VPPANVYAFAFYIF 75  Nitrosococcus o...
WP_011795849   6 FLDALASERRHNDRLtKTMAGVIALGIVSTWFAWRQ-PKSVDVHLAPDVRAGDTVR---VSDgrspVPSPNVYGFAYYIW 81  Acidovorax citr...
WP_011236073   4 LTAALANRDATIRRQaWFIAALMVLLLIAL-VSWRTTATDIIAHVPPDLSRGATLQlgrVTE----VPHPNVYGFGFYIW 78  Aromatoleum aro...
WP_011805410  76 QQVQRWPTNGEEDYPRNLRALSAYLTPSCRAFLQQDYEYRRASGELRQRVRGIYEIPGRGYGDdpaS---RVKMVSDRDW 152 Proteobacteria
WP_012105786  76 QQLNAWPKNGEVDYPAKIIQLAPYLTPACQSFLHQDARFRTDNGELRDRVRVVYEIPKRGYSN---K---SVDIKSDNEW 149 Yersinia pseudo...
WP_000086082  76 QQINAWPKDGEKDYPMKIAQLSPYLTPSCQDFLNKDAELRSQKGELLDRVRVVYEIPKRGYKP---E---SVIIESDDSW 149 Salmonella ente...
KEA11436      75 QQVQRWPKDGEVDYKGNLFRYAAYLTPSCKVFLEKDFEFRRNAGELRGRERTTSEIPGRGIGE---Sn-gRVIQHSINDW 150 Pseudomonas aer...
WP_011092186  76 QQLNAWPKNGEQDYPGKIFSLSPYLTPSCLDFLNADAKKRSLGNELLDRVRVVYEIPGRGYSA---E---SVDVISRDNW 149 Pectobacterium ...
WP_011334416  76 GQLNRWPSDGEQDYRRAIYGLQSYLTPSCKAFLEGDYEYRKAAGELRQRVRGVYEILGRGYSE---DpelRVKQLDRDSW 152 Pseudomonas flu...
WP_011609903  76 QQLNRWTLDGTQDYEKNIEALKPFLTPSCEAFLQQDYEDRQRHSELRDRVRGVYEIPGRGFSN---N---RVIVHNRDSW 149 Histophilus somni
WP_002813822  76 QQLNRWPENGATDYGNAIFRISPYLTPRYRNDLIEDMELKARRGELAYRVRGVHEVPGHGYEE---R---RVDVLSSDAW 149 Nitrosococcus o...
WP_011795849  82 QQVNRWQTDGAQDYGQQIFNLQYYLTPRCQAQLQADMELRQGKGELRRRTRQISEIPGFPYSE---N---RVLADGPDAW 155 Acidovorax citr...
WP_011236073  79 QQVNRWAKDGSKDYGAQIFALQHYLTPSCREQLLQDLQIKAGDAELIQRTRALMEIPGYGYSA---N---RVSNHGNGGW 152 Aromatoleum aro...
WP_011805410 153 IVMLDVSADEYYGSEQVKRALVRYPIKVVRLDIDPERNPFGLALDCYAGA-PQRIEP 208 Proteobacteria
WP_012105786 150 RARLDLVADEYYHSEPVKRVMVRYPIKVIRWEGDPERNPFGLAIDCYDGV-PQRLEA 205 Yersinia pseudotuberculosis
WP_000086082 150 EVSLDLVVDEYYHTEPVKRALARYPLHIVRWEGDPERNAFGLALDCYKGV-PQRLEA 205 Salmonella enterica
KEA11436     151 TVNLDMDSTEYYAGEKIKRALARYPLHVIRADVDPETNPFGLQWDCYSDT-PQRIEL 206 Pseudomonas aeruginosa C1913C
WP_011092186 150 VVRLDLVTDEYYHTEPVKRVLVRYPLKVVRWDGDAERNPFGLALDCYDAM-PQRLEI 205 Pectobacterium atrosepticum
WP_011334416 153 LVKLDLNADEYYSAEPVKRVVVRYPLRVVRFDQDPERNKWGLALDCYQGT-PQKISL 208 Pseudomonas fluorescens
WP_011609903 150 TVNLDLSVDEYYKDEPVKRVLTRFPISIVRMDIDSKRNPWGLGFNCYASI-PLRLEV 205 Histophilus somni
WP_002813822 150 IVWLDLDLLESVKGMTVKQTTIRYPVRVVRQAIDPETNPWGLALDGYASDgPRRLTD 206 Nitrosococcus oceani
WP_011795849 156 TVLLDMQVTETFGGQAVKDVFIRYPLRVVRFDVDRERNPWHLALDCFGANrPARLNP 212 Acidovorax citrulli
WP_011236073 153 TVLIDAQLIETSRAMPVKDAFVRYPLHVVRYDVDREKNPWGLALNCFGGRhPERIDP 209 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap