Conserved Protein Domain Family
galliderm_ABC

?
TIGR03740: galliderm_ABC 
gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit
Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Statistics
?
PSSM-Id: 163452
View PSSM: TIGR03740
Aligned: 8 rows
Threshold Bit Score: 323.197
Threshold Setting Gi: 447019535
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001002804   6 LETKNLCKTFRQQSVVQNISLSVPKYAIYGLLGPNGAGKSTTLKMITGMLIPTSGEIYFDGHKWTRHDLHSIGALIDSPP 85  Bacillus anthracis
WP_025985690   5 LETKNLTKQFGKQTAVNQLNLKVERHSIYGLLGPNGSGKSTTLKMITGMLRKTSGHILIDGHDWSRKDLENIGALIESPP 84  Streptococcus m...
WP_011986262   6 LQTKDICKVFKGQHAVNNISITVRENSVYGLLGPNGAGKSTMLKMLTGMLRPTSGKIIFDNHHWTRKDLVSIGALIEAPP 85  Clostridium bot...
WP_011246061   6 LETKQLSKRFGKQAAVAGVSLRVPKNSIYGLLGPNGAGKSTTLKMLTGILRPSSGEILFDGSHWNRSMLKDIGSLIEAPP 85  Bacillus clausii
WP_009889121   6 LQVKGVSKKFKEQMAVDNISLAIKSNSIYGLLGPNGAGKSTLLKMITGILNPTSGKIMFEGHRWTRKDLSNIGSLIESPA 85  [Clostridium] d...
WP_008881431   6 LETHHVSKAFGKQLVVDDVSIKVKKQTVYGLLGPNGAGKSTLLKMLTGLLRPTKGEIMINGHPWSRKDLKDIGVLIESPA 85  Geobacillus
WP_011528612  21 LKIQNLKKSYGKRTILNNVNMNIPKGKVYALIGPNGAGKSTIMKILTGLVSKTSGSIIFEGREWSRRDLRKIGSIIEEPP 100 Streptococcus p...
WP_001096791   4 LVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSGEIKLDNRPMTRNDLHKVGSLIETPA 83  Staphylococcus ...
WP_001002804  86 LYENLTARENLQVRTTVLGLPKSRIDEVLHVVELENTEKKKAKDFSMGMKQRLGIAIALLNHPKFLILDEPMNGLDPFGI 165 Bacillus anthracis
WP_025985690  85 LYENLTAHENLKVRTLMLGLPDSRIDEVLKIVDLTNTGKKRAGQFSMGMKQRLGIAIALLNSPQLLILDEPTNGLDPIGI 164 Streptococcus m...
WP_011986262  86 LYENLTARENLKVRTTLLGLKDSRIDEVLKIVDLTNTGKKTAGKFSMGMKQRLGIAIALINNPKLLILDEPTNGLDPIGI 165 Clostridium bot...
WP_011246061  86 LYGNLTAFENVKVHALLRGLPTQRIEEVLHTVDLTHTGKKKASQFSMGMKQRLGIAIALLNQPKLLILDEPTNGLDPLGI 165 Bacillus clausii
WP_009889121  86 IYENLTARENLKVHTTLLGLPDSRIEEVLETVDLRDTFKKRSGQFSLGMKQRLGIAIALLNHPKLLILDEPTNGLDPIGI 165 [Clostridium] d...
WP_008881431  86 LYGNLTAHENLLVHAKLLHLPESRIQEVLNIVGLENTGKKKASQFSLGMKQRLGIAKALLNHPKLLILDEPTNGLDPLGI 165 Geobacillus
WP_011528612 101 LYKNLSAYDNMKVVTTMLGVSESTILPLLNKVGLGNIDKRPVKQFSLGMKQRLGIAISLINSPKLLILDEPTNGLDPIGI 180 Streptococcus p...
WP_001096791  84 TYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLNVDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGI 163 Staphylococcus ...
WP_001002804 166 QELRKLILSFPGKGITVILSSHILSEVSQIADHVGIISGGVLGYQGKLNKNDDLEDLFVQVAG 228 Bacillus anthracis
WP_025985690 165 QELRNLIRSFPTQGITVIISSHILSEIQMTADHIGIIANGVLGYQDRIHQDEDLEKLFTEVVM 227 Streptococcus mutans
WP_011986262 166 QELRELIRSFPKQGITVILSSHILAEVQLIADHIGIISNGILGYEAKINPSENLETLFTEVVK 228 Clostridium botulinum
WP_011246061 166 QELRELITSFPQKGMTVILSSHILSEVQLMADHIGIISEGRLGYQDSIKGKDDLEGLFMEVVK 228 Bacillus clausii
WP_009889121 166 EELRKLIRSFPKQGITVILSSHILSEVEQVVDEIGIISNGVIGYQGEVSKEQNLEKLFMKVVA 228 [Clostridium] difficile
WP_008881431 166 QDLRKLIQSFTENGITVILSSHILSEVKQLADYIGIIQNGKLRYEGKIDESQDLEKLFVDVVN 228 Geobacillus
WP_011528612 181 QELREIIESFKSEGMTIMISSHILSEVEHLADFIGFIYEGKIILEKEYDGSENLEELFNNQIL 243 Streptococcus pyogenes
WP_001096791 164 QELRELLKLLTEQGTSIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITK 226 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap