Conserved Protein Domain Family
PRTRC_C

?
TIGR03738: PRTRC_C 
PRTRC system protein C
A novel genetic system characterized by six major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. It is often found on plasmids. This protein family is designated PRTRC system protein C.
Statistics
?
PSSM-Id: 163450
View PSSM: TIGR03738
Aligned: 8 rows
Threshold Bit Score: 113.691
Threshold Setting Gi: 500128861
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011001602   2 QTIQLTREFRYNGVRLADPSPQFTLEQVRDFYANTYPEILNADIDGPSVEGTLQVYGFRRAVGRKG 67  Ralstonia solanacearum
WP_012217989   4 SIAALVREFTYNGVALMDPGPAFSPDQVRDLYTAQYPELTTAAVDGPDMKGEVAHYKFVRAAGAKG 69  Burkholderia multivorans
WP_011486342   9 STTVLKRVFMSNGNPLTDPDPSMSPAAVKDFWSAMYPELLNAEVQGPVSKDGELTYTFHRTTGTKG 74  Polaromonas sp. JS666
WP_011154222   4 EIKKLLRQFSYNGMSFVDPGPAFTPEQVRDIYSAQYPELTTASVDGPEVKGEVASFTFVRAAGAKG 69  Cupriavidus necator
WP_011485910   3 KEVTISRVFTYNGIRLDDPNPALQPDAVREFYLPHYQELNTAVVEGPVTKDNVATYTFRRAAGAKG 68  Polaromonas sp. JS666
WP_011797949   4 IAKTISRTFKFNGMTLADPSPEMDMETVKRFYANQYPELLNSVVEGPVTKGTVSTYTFIRAVGAKG 69  Polaromonas naphthalenivorans
WP_011804866   4 EVTPIVRTFTYNGILLPDV-PGLSPREVRDLYSAQYPELVSAEVEAGSVANGRQDYTFRKAVGTKG 68  Acidovorax sp. JS42
WP_011288272   4 AVNEIRRVFRYNGVQLPDV-PGMEPKEVRDLYSAQYPELISAEIEAGDVVNGVQEYTFRKAVGTKG 68  Dechloromonas aromatica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap