Conserved Protein Domain Family
PRTRC_ThiF

?
TIGR03736: PRTRC_ThiF 
PRTRC system ThiF family protein
A novel genetic system characterized by six major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. This family is the PRTRC system ThiF family protein.
Statistics
?
PSSM-Id: 163448
View PSSM: TIGR03736
Aligned: 9 rows
Threshold Bit Score: 362.841
Threshold Setting Gi: 500107184
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011001598   6 HITPPRML--SAQVRVVLVGCGGNGSQMLTGLARLNHAIRALGHP-GLAVEVYDPDTVSEANMGRQLFSPADVGHYKAIV 82  Ralstonia solan...
WP_011797953   3 HKVHPELI--RRAINVVVIGAGGTGSRVIEGLACLHRAIKAKGHPfGLKVSVIDPDTVSEANVGRQAFYPCDVGHSKAHT 80  Polaromonas nap...
WP_011485923   3 HKLHAALL--TKPVKILLVGAGGTGSQMMVKLVNLHKAMVALGHPhGLKVMVVDPDVVSHANIGRQNFYPGDVGSFKADV 80  Polaromonas sp....
WP_011486338   3 HAINPQLL--QKTISVALVGAGGTGSQVITALAQMHYALVKLGHPgGLSVTVYDDDRVSESNIGRQWFFPADLGQYKADV 80  Polaromonas sp....
WP_011458648   4 YKIPSAFL--AKPVNVAVIGAGGTGSAVIACLAQMCVALEALGAP-GLDVTVIDDDRVSPANIGRQAFAPCDVGQFKASV 80  Albidiferax fer...
WP_011254879   3 HFIIPDLL--QRKVRIVVVGAGGTGSHVINGLVQLHTALLALGHPaGLHVTAFDDDTVSESNVGRQAFAWSDIGANKASV 80  Aromatoleum aro...
WP_011288268   3 HLIDPALL--DRRVSIHLVGVGGNGAQMAACLARLDIAMKAFGHPyGLHVTAFDADRVSEANVGRQLYSPADIGRHKAIV 80  Dechloromonas a...
WP_011154218   5 HRIPANMT--TRAWKVVVVGAGGTGSALLPNLARLHHAMLELGHPgGIDCTVYDDDTVSETNIGRQGFYPVDVGQHKATL 82  Cupriavidus nec...
WP_011783189  10 RTAPPSFLnaSSPLDILMIGAGGNGSELFDGLVRLHHALITLGGK-GLAVTVMDDDEVSPSNVVRQRFWPHEVGANKAIA 88  Marinobacter hy...
WP_011001598  83 HTQRINHFF-G--LDWRAQPRKYER-GEYAH---PaavP---A---LFIACVDSAAARQQLDTAISg------------- 136 Ralstonia solan...
WP_011797953  81 LVNRVNMAL-NgeAVWTAYCEMVTL-QTDLS---S---A---D---IVIGAVDNRKARLAILRSLEnv------------ 134 Polaromonas nap...
WP_011485923  81 LVTRANMALeN--TVWESNIGKLDT-RSSLC---D---Y---D---IVIGAVDNRAARLGILRGLEgt------------ 133 Polaromonas sp....
WP_011486338  81 LVQRVNMTM-G--TDWTSCPSKVSM-SDTLH-------F---D---IVIGAVDTRKARLSIMRAMErg------------ 131 Polaromonas sp....
WP_011458648  81 LVNRVNQTF-G--LDWDAKNERLAV-LPARH---N---Y---DmprIYIGCVDTRKARQAIKSHWEassn--------sg 139 Albidiferax fer...
WP_011254879  81 LINRLNQAF-G--LDWEACPERIGV-SRTGRlrmR---P---D---LVIGCVDNRLARKAIASTF--------------- 132 Aromatoleum aro...
WP_011288268  81 TIHRLNQFY-G--LDWIAHPTRYEAfETNRY---S---PlsaD---ILVSCVDSRSARRILHEAVFdg------------ 136 Dechloromonas a...
WP_011154218  83 IVNRLNNLM-G--TRWEAHTRRVASgDRFVC-----------D---MAIGCVDTRAARKAILGAMKrg------------ 133 Cupriavidus nec...
WP_011783189  89 LVQRANLMM-G--TNWTALPERFNR-NSRLG---R---F---D---LVITAVDNLDARREALARFEpddrhqnnpwivng 152 Marinobacter hy...
WP_011001598 137 -rMNT--YLLDLGNRASDGQVLFGQTPATlqdgA----VGNARFNppgsapLPYPYAVLPELIDTIm-PEDDAPSCGLAE 208 Ralstonia solan...
WP_011797953 135 ssGNR--YWLDLGNRISDGQVILGEVTSR----Kr---KTDDPER------LPHAGELYPELIDPAmePSDDVPSCSLAE 199 Polaromonas nap...
WP_011485923 134 rsGVR--YWLDTGNRRADGQVILGEVSSRs---K----VGEDKLR------LPHVGELYPEMIDPAqeDKDDTPSCSLAE 198 Polaromonas sp....
WP_011486338 132 psG-A--YYLDFGNRAKDGQAILGQVVGA----N----RKTNGGT------LPHVGELFPEVMDPKvvDPDEGPSCSLAE 194 Polaromonas sp....
WP_011458648 140 fnGTA--WWLDCGNTAHSGQVILGV-------------LTEGVVE------LPSAGHLFPEMVDASldASDDMPSCSLPE 198 Albidiferax fer...
WP_011254879 133 --GYG--YWLDIGNNQNDGQVILGEIGEG----HyvtwHGKKRLR------LPTVADLLPEAVDERldQTDDQPSCSLAD 198 Aromatoleum aro...
WP_011288268 137 ggRYR--YWLDLGNTEASAQVVLGQGPRR----A----KGEVNLR------LPCVTELFPELLDASv-PDDNRPSCSVRV 199 Dechloromonas a...
WP_011154218 134 tgG----YYLDCGNESDSGQVILGQV------------RGKAAQR------LPHVGDLFPELLDPKgdKADTAPSCSMAE 191 Cupriavidus nec...
WP_011783189 153 yrGHAdtYWLDLGCDKDKGQVVFGR-------------FGDNQISd----eWPTALAHFPEMATR---EDDNRPSCSAAE 212 Marinobacter hy...
WP_011001598 209 ALARQELFVNQAIVTPALAILWEFFRYGRLTWHGAFVNLKTGSMRPMHVR 258 Ralstonia solanacearum
WP_011797953 200 ALEKQALFINPAVCVQAMNLLWLLLTKGELEIHGAFINLEFGTVLPLRVD 249 Polaromonas naphthalenivorans
WP_011485923 199 ALSKQSLLINPTIADFAGNILWQLFTNGEIENHGVFVNLDRMMVMPLKVD 248 Polaromonas sp. JS666
WP_011486338 195 ALARQSLFINRTLVSHGMAMLWDLLRHHKITFHGVFVNLETGRVTSLPVC 244 Polaromonas sp. JS666
WP_011458648 199 ALAKQDLFTNRTIADTAMNLLWKLFRYGETDVHGAFVNLQTMRTNPLPID 248 Albidiferax ferrireducens
WP_011254879 199 ALEKQSLFINRAMALHALNLLWKLFRLARLEAHGVFVNLATDRSSPLMID 248 Aromatoleum aromaticum
WP_011288268 200 SLVSQGLFINDVAVRFAAQLLYELFSKGRLDQHGVVVNLDSKRTGPIEVD 249 Dechloromonas aromatica
WP_011154218 192 ALQKQSLVINQAIAVQAYNLLWTLFRTGTLKYCGAFVNLAVGRTNPLPVD 241 Cupriavidus necator
WP_011783189 213 SLARQDLMINQSVSGAAINMLWKLLRESKLGFNGVMLDLATGYSQGIPFM 262 Marinobacter hydrocarbonoclasticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap