Conserved Protein Domain Family
PRTRC_A

?
TIGR03735: PRTRC_A 
PRTRC system protein A
A novel genetic system characterized by six major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. It is often found on plasmids. This protein family is designated protein A.
Statistics
?
PSSM-Id: 163447
View PSSM: TIGR03735
Aligned: 8 rows
Threshold Bit Score: 287.339
Threshold Setting Gi: 499777913
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011001599  54 DAKLWDSAPTVAVPK-FAEFKQLEDVGHRFLATAEGLFVEVRRPWLHVIQPVAPLNGQt-VrpPYGTVKQ-KVDLAFERL 130 Ralstonia solan...
WP_011485922   4 DSIIQGMFPTVIMPR-EGTIAPATKNGTRYVVAGDGLWREVVLPWVTVMHKIANSDFM--L--PYGAAEE-AVVIKCGPI 77  Polaromonas sp....
WP_011254878   5 DMALQALTPTVMVPR-FGCFEPLSQPGHRFLVGQNGEWLEVRRAWMYARVQLTQPSPVv-K--PYGVVTA-CLEWLCPPI 79  Aromatoleum aro...
WP_011797952   4 DQITMGVFPLLAASQ-TGVLQDPEKHGVRYVAASDGMWRAIDTAWLKALTPVALSSKKa-Vi-PYGRLTQ-SVEFLCSMP 79  Polaromonas nap...
WP_011486339   2 DAIIQSQFPTVLAPR-FEALSPLETTGDRFILTRHQVLMEVSRPWLHAIQAISAPFARq-T--PYGAGPRlGIKLRCGPV 77  Polaromonas sp....
WP_012217992   5 DTVLQQSFPSVMVPS-REAVVPMTRSGERLLITSDGVYLEVLRPWVRVVRRIAHYAVStaV--PYGQVEE-TTAFSCGQI 80  Burkholderia mu...
WP_011288269   6 DLALQAVCPVIAAPR-FGPLPDMAN-GQRIILAANGVFVQVKLDWLDCIQRLSPALPIt-L--PYGGIEE-RLAFTFGVL 79  Dechloromonas a...
WP_011458647  10 DRFLATDCPVITMPHdSEVFEPLKTPGHRLIVAAGGLYKEIRRAWLHAIVHVARAQ----T--PFGELQT-TLSMPF-QV 81  Albidiferax fer...
WP_011001599 131 GATfpMVRAFIEAARKAAPNEHAAWVVWDSRTGDLAYRELQITDASPGAISYDRPRLEDHESLVVDMHSHGALAAFFSEQ 210 Ralstonia solan...
WP_011485922  78 PTE--LRSKFVQDAKAAMPNEMAAAVIWNSNDHSWRYEMRENTTASTAHIDYREVHLGDGEFLVLDLHSHGTFSAFFSQE 155 Polaromonas sp....
WP_011254878  80 PLS--LFERFAGIARESCPLEAAGWITWNEVSNQFAFREVGVREASASRIHFDRPRLDESEHLVVDLHSHGASSAFFSGT 157 Aromatoleum aro...
WP_011797952  80 PAS--LWREFAVLAKSTLPNEVAAAMVWNAEQDTWRLAARQSIEANPGFVRYREVELQEGEHFVVDIHSHGNHSAFFSET 157 Polaromonas nap...
WP_011486339  78 PKA--LLDRFVLQARAATPMETAAWIVWEAETCQFRYLPLANISVSAGHVKFERPQLEDGVHLVMDIHSHGELPAFFSEQ 155 Polaromonas sp....
WP_012217992  81 PAA--LVAEFHAMARAALPNEVGAWIVWNSMTGAFRIVALPSVSHGPGHLVYERPRLADGEWLVVDCHSHGTGSAFFSRT 158 Burkholderia mu...
WP_011288269  80 PIR--VIEAFIEAARRGLPNEVAGALIYSRRNQSLRLALCEPIEVSPHQIDYRVPTMDADETLAVDLHTHGYGSAFWSAK 157 Dechloromonas a...
WP_011458647  82 PEN--LLVEFLHQARAAAPNETAAWIVFNEGDRSLRLLPMEYDGVTPVHLSILRPMLAAGEHLVVDLHSHHQMSAYFSRT 159 Albidiferax fer...
WP_011001599 211 DNRDD--AGEVKISCVVGDLaDGKTPSIQFRLCVLGMFLPLK 250 Ralstonia solanacearum
WP_011485922 156 DDRDD--KGSMKFSGVIGNL-NSGNMTSVLRMNMLGQTWDAN 194 Polaromonas sp. JS666
WP_011254878 158 DDFDD--RGEVKLSIVLGRC-DQRVVTAQ-RFCLMGMFVPMQ 195 Aromatoleum aromaticum
WP_011797952 158 DDCDD--FGSTKVSAVLGCV-GQGATQVRIRLMLIDKHIDLK 196 Polaromonas naphthalenivorans
WP_011486339 156 DNADD--ADQLCISAVLGRV-SDETPQFVSRLSMLGVAVNLM 194 Polaromonas sp. JS666
WP_012217992 159 DNQDD--KHDVKLALVLGHC-D-RTPSVVLRLCAKGIFEKFE 196 Burkholderia multivorans
WP_011288269 158 DDGDD--QG-IKVAGVFGCL-HQPKPQALFRLVVNGRFRPLP 195 Dechloromonas aromatica
WP_011458647 160 DDADDiaSNEVKIAGVVGTI-HQ-NPTWNFRMCLEGVLMPDF 199 Albidiferax ferrireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap