Conserved Protein Domain Family
lanti_perm_MutG

?
TIGR03733: lanti_perm_MutG 
lantibiotic protection ABC transporter permease subunit, MutG family
Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family is largely restricted to gallidermin-family lantibiotic cassettes, but also include orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes. In most species, this subunit is paralogous to an adjacent gene modeled separate by TIGR03732, while in some species only one subunit is found.
Statistics
?
PSSM-Id: 163445
View PSSM: TIGR03733
Aligned: 10 rows
Threshold Bit Score: 206.398
Threshold Setting Gi: 499224736
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004888811   5 RLLSSEWIKTKRTAIRMMVIITPIIYSLFMVWYFSHYRTSTfwqMKIYQGFFEVMAV-SLPIIISLLTGLMSYQEEKAGS 83  Bacillaceae
WP_003178631   6 RCLAADFQKTKRTSFIWLHLSVPVICAGVFLLYFYNRQPDP---YQLYRTYFEAIAI-ALPLLIGIVCGMTASLEEQAGR 81  Bacillus lichen...
WP_011178777  14 RVLRADFIKMKHTIFFWIHVAMPIIGIALFLSYYSFSKLDS---INKVLGYIQVLSI-SFPLLISIVCSSVVEQEALAGN 89  Bacillus anthracis
WP_011246059   5 RCLYADVLKTKRTAFMWVHLLAPLLYSAVCLLYFHVRELDG---AHIYELFMTPLAI-ALPFVVALVCGLSVSQEERAGH 80  Bacillus clausii
WP_011098904   5 RLMKADFIKMKHTSFYWIHICLPVVGIVMFLGYYSFSILGS---IGKVNGYLDALSL-VFPVLIGIICSTVIEQEVMAGK 80  Clostridium tetani
WP_003405369   6 RCIKSDFYKLKRTPILWLHVFIPILGSFLFLLYYSFGSKGN---IDSICGYLETVAI-VFPLLIGLMSGMVIEQEERTGN 81  Clostridium bot...
WP_009889124   6 RIFCSDLIKLKRNFIILMHICIALMGMGLFLWYYKVSGADN---ILKIVAYLQVIAI-AFPLLSGVVCSMFVEQEYYAGN 81  [Clostridium] d...
WP_009895519   3 KLLSSEWLRAKRTAVQWLTLCMPIIFSLCVVFYLTTKSGSTq--EFAFEGFFTVWTVfIIPIGVGILAGFIVQEEELAGN 80  [Clostridium] d...
WP_004027243   3 NILKSEFYKLKHTWIPWAHFILPILYALLFYGAATITGLKNfsdMDIIQNYFVLLGA-VLPIICGVITSKIVDMEVSAGR 81  Ureaplasma urea...
WP_010922276   3 SYLCSNFLKIKNTSYLLIHILAALLFPLLLFFYWSQRGGLQs--RTVLFSYFQIVGV-LLPFVASIVCIQLKNLEESSGK 79  Streptococcus p...
WP_004888811  84 FMNILTGPVSKVQWYVGKLTLLIFIACADILLATILMLFGMKYVLKVAHIHYQLFLQGAMLSIVGSLILFSLHLFISFAF 163 Bacillaceae
WP_003178631  82 FQVLLGGTAPKLTAYLSKVTLLLIMNIFAVFLAIGLYLLGLRALFHVPNLPSSLFLEAGAWLAAGSVTLYFIYFLISCTF 161 Bacillus lichen...
WP_011178777  90 FKELLSTEYGRRKALISKVCLLLICGFCSTMLAVVGFATGFHFLLGQNEIPFALYVEISFILFSCQIFMYIWHLFLNFRF 169 Bacillus anthracis
WP_011246059  81 FQNIVGAPLPKLIPYFSKMIFLILLNGVSIFLAIGLLSLG--FLLSHAELPLLPFLIGGAWLVATSVVLYFFYFFVSCLF 158 Bacillus clausii
WP_011098904  81 FKEMLSIEYGKGICLLSKILVVLVMGFFSLSLAVGGFFIGFEYVLKQNILPFKFYVILTLLIFVSQIFIYLFHLWLSIKF 160 Clostridium tetani
WP_003405369  82 FQMLLSSTKCKSITYLSKLVLLLLLGIFSVIIAIGVFALGFK------KMDAMFYVQEAVVLFVANVLLYILHVLVTLKL 155 Clostridium bot...
WP_009889124  82 YKHMLTTSNPKYLTLISKYIILVCLGFVATLVSVLGFKFGIS----KAYFTSSFYMISILILIGCNLFEYILHLFLSLRF 157 [Clostridium] d...
WP_009895519  81 FNGFLCVGISRVRLYLGKFLFLLFCLTICTFIATLILCIGMS-IAVPSGATIWLFLSAAGLVVIGTLPLLAIHLWVSFAW 159 [Clostridium] d...
WP_004027243  82 FQVLLSTTKSRSKAYGGKLLMLLFSFLFSTSLAVLIFAMLFG------NQENIAWLIELLLVVIGCLSTYMIHLWVSIML 155 Ureaplasma urea...
WP_010922276  80 YKYLLGYSQSNYKPFIVELVFLWLCYCIVLIISITIFILLLKTI--GINVSLRLLILNSLIYIIFAYVTYLINHIISYIF 157 Streptococcus p...
WP_004888811 164 GMGASIAVGSGGFLISALI-GaTSLGDHVWSYIPWAWAVRLSQFPIL-MmpevKQTLGA----QLLSSFSLSLWEGIAYA 237 Bacillaceae
WP_003178631 162 GMGASILAGGAGLLMTALM-N-TGLGDVIWKYNPWAWGIRLTGYKGI-Dr---FVQIDP----SLRSVLDGEIKQGAFIM 231 Bacillus lichen...
WP_011178777 170 SKGASIGIGIIESLLAALM-L-TGMGDVIWKYTPCAWSMRLCNYFLE-Y------KLSP----SSIRALPVEAATGAVIC 236 Bacillus anthracis
WP_011246059 159 GIGASALFGVAGLLMTALM-G-TGLGDAWWKYNPWAWGTRLSGYAGI-Ve---FEQMEP----VFLSFLQQELRTGFMIV 228 Bacillus clausii
WP_011098904 161 GSGASIGMGIFESLFSALI-I-TGLGDGIWQWIPCAWSVRFCNNFFI-Kd---TNSVDTfnklADFNIGLSVNRIGFRNC 234 Clostridium tetani
WP_003405369 156 GRGASIGLGIAGTLLSALM-L-TGLGDRVWQWTPWAFGVRFCDYTML-------KIIDP----SNYNIVSRDVNKGFFIM 222 Clostridium bot...
WP_009889124 158 GKGTSIGVGIVEMLLSALL-L-TGLGSGIWQYFPCAWGVRFITIWSSfSs---SKTVEY----IKVESIKAYQSTGLM-C 227 [Clostridium] d...
WP_009895519 160 GMGASIGISIGGILMAAILgL-TSVGEKVWAFVPWTWPVKLGMLPGI-Yf---IKEAGTisteAFYSKVMQTASIELIVV 234 [Clostridium] d...
WP_004027243 156 GSGASIGLGFVGTLIALLS-I-TNLGENIWYFFPCTWSSRLSATYIV-Gs---KLANS--------SYLIKELTTWVYVA 221 Ureaplasma urea...
WP_010922276 158 STGVALGISMVGVIAAAFC-E-TSLGDKVWFLIPWAWLLRISDTLYN-Qq---KMAIVP-----------------LIVI 214 Streptococcus p...
WP_004888811 238 LLSFIIVTIIGSIWFHRWEGNQ 259 Bacillaceae
WP_003178631 232 VFAIIAVFALSIIWFIRWEGRK 253 Bacillus licheniformis
WP_011178777 237 VCFTIIAFVISLMWFSFYEGRK 258 Bacillus anthracis
WP_011246059 229 ASVILFVTVISSIWFHRWEGKK 250 Bacillus clausii
WP_011098904 235 IIYTIILGIVFGIWFNFFEGRK 256 Clostridium tetani
WP_003405369 223 IFEICIALIASLLWFKYWEGRK 244 Clostridium botulinum
WP_009889124 228 GFVTILAFVILCIWFSKWEGKK 249 [Clostridium] difficile
WP_009895519 235 AIGLIIFLIGGVIWFKMWEGRK 256 [Clostridium] difficile
WP_004027243 222 LPITVAIFIGSLLWFNRWDGKS 243 Ureaplasma urealyticum
WP_010922276 215 FFVSCTVALLHIRIFKRWNQDC 236 Streptococcus pyogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap