3CFZ,3CIJ,3CFX,3CG3


Conserved Protein Domain Family
tungstate_WtpA

?
TIGR03730: tungstate_WtpA 
Click on image for an interactive view with Cn3D
tungstate ABC transporter binding protein WtpA
Members of this protein family are tungstate (and, more weakly, molybdate) binding proteins of tungstate(/molybdate) ABC transporters, as first characterized in Pyrococcus furiosus. Model seed members and cutoffs, pending experimental evidence for more distant homologs, were chosen such that this model identifies select archaeal proteins, excluding weaker archaeal and all bacterial homologs. Note that this family is homologous to molybdate transporters, and that at least one other family of tungstate transporter binding protein, TupA, also exists.
Statistics
?
PSSM-Id: 163442
View PSSM: TIGR03730
Aligned: 18 rows
Threshold Bit Score: 416.393
Threshold Setting Gi: 500158727
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CFZ_A         5 IVLKIFHAGSLSVPFEEYEKMFEKEHP-----N-----VDVEREPAGSVACVRKIIDLGKKADILASADYSLIPQMMMPK 74  Methanocaldococ...
WP_011341839  31 GKLIIFHAGSLSVPFAAMEKAFEAKYP-----G-----VDVLREAGGSTKMARLISEAGKPADIMASADYTVIDKTLIPG 100 Pelobacter carb...
WP_010867274  32 aKLIIFHAGSLSVPFSQLESEFAKYAE-----KelgikVTFQDEASGSVKAVRKVTDLGKKADIVAVADYTLIPQLMVPN 106 Pyrococcus abyssi
WP_011020338  41 EVLTVFHAGSLSVPFEELEAEFEAQHP-----G-----VDVQREAAGSAQSVRKITELGKKADVLASADYALIPSLMVPE 110 Methanosarcina ...
WP_011418456  33 GTVVMFHAGSLTMPFEAMEKEFEARYP-----G-----VDLQREASGSQAAARKVTDLNKPCDIMASADFKVIDKLLIPK 102 Syntrophus acid...
WP_011011192  33 VTLIVFHAGSLSVPFQEVEKEFSEYAErnlgiK-----VSFQDEASGSVMAVRKVTDLGRKADVIGVADYTLIPQLLIPN 107 Pyrococcus furi...
WP_011187806  30 EKLVIFHAGSLSVPFKVMEKAFEKQHP-----N-----IDILREAGGSTKMARMISELGKPADIMASADYVVINKNLIPK 99  Desulfotalea ps...
WP_011341836  31 GKLIIFHAGSLTVPFAAMEKAFEARYP-----E-----VDVQRESGGSTRMARLISEVGKPADLMASADFQVIDHSLIPA 100 Pelobacter carb...
WP_011838584  37 SEIIIFAAGSLKIPLDEIASKYSEKY------G-----VNIYIEASGSVEAIRKVTDLGREADIIAVADYRLIPTFLVPN 105 Staphylothermus...
3CFX_A         5 EVLTVFHAGSLSVPFEELEAEFEAQHP-----G-----VDVQREAAGSAQSVRKITELGKKADVLASADYALIPSLMVPE 74  Methanosarcina ...
3CFZ_A        75 YADWYVMFARNEIVLAYTDKSKYKD--EI--NSTNWYKILQRPDVKIGFSNPNDDPCGYRTQMVLQLAELYYKDPTIYDN 150 Methanocaldococ...
WP_011341839 101 NAVVNVRFATNQLVLCYTDKSKFAD--EI--NAKNWPEILQRQGVIWGHSEPNLDPCGYRSLMVLQLAEKFYNQPGLSDK 176 Pelobacter carb...
WP_010867274 107 YTDFYVLFATNEIVIAFTEKSKYAD--EMlkNPDKWYEILAREDVSFGFSDPNQDPCGYRSVMVMKLADLYYGKP-IFET 183 Pyrococcus abyssi
WP_011020338 111 YADWYAAFARNQMILAYTNESKYGD--EI--NTDNWYEILRRPDVRYGFSNPNDDPAGYRSQMVTQLAESYYNDDMIYDD 186 Methanosarcina ...
WP_011418456 103 HADWNIRFATNELVLCYTDKSKFAK--EV--NAKNWYNILQRKGVVWGHSDPNLDPCGYRALMVLQLAEKYYKKPGLYEK 178 Syntrophus acid...
WP_011011192 108 YTDFYVLFATNEIVIAFTDKSRYVE--EMksNPDKWYEILAREDVRFGFSDPNQDPCGYRSLMVIKLADLYYGKE-IFKE 184 Pyrococcus furi...
WP_011187806 100 YADINIRFATNQMVLCYTDKSKYAD--KI--NSSNWPEILLRSDVVWGHSDPNLDPCGYRSLMVLQLAEKHYKIENLNEK 175 Desulfotalea ps...
WP_011341836 101 LADFNIRFATNELVLTYSEHSKFAD--QI--NQDNWFEVLGRPGVVWGHSDPNIDPGGYRSLMAIQLAEKYYRQPGLYQR 176 Pelobacter carb...
WP_011838584 106 YTSWYIGFATNQVVLVYTDKSKYHEilEN--NPSEWYKILMRNDVKWGFSDPNKDPCGYRSVGIIGLASIYYNDTSILEN 183 Staphylothermus...
3CFX_A        75 YADWYAAFARNQMILAYTNESKYGD--EI--NTDNWYEILRRPDVRYGFSNPNDDPAGYRSQMVTQLAESYYNDDMIYDD 150 Methanosarcina ...
3CFZ_A       151 LVLKHSNIKV-EENNGTYLILVP--KELDV-DTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKEINL 226 Methanocaldococ...
WP_011341839 177 LL---------------------------A-NRPQANVRPKAVELITLLQNGDMDYAWEYRSVAVQHGLKFITLDDHINL 228 Pelobacter carb...
WP_010867274 184 LVEKTTNIYA----NGTH-IYAP--KEIIV-KDKRVVIRPKETDLVGLVESGSLDYFFIYKSVAEQHNLKYITLPNEINL 255 Pyrococcus abyssi
WP_011020338 187 LMLANTGMTLtTEENGTALIHVPasEEISP-NTSKIMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPAIDL 265 Methanosarcina ...
WP_011418456 179 IL---------------------------A-NRPVENIRPKSVELVSLLQTGNMDYAWEYRSVAVQHNLKYVSLPDKINL 230 Syntrophus acid...
WP_011011192 185 LIEENTNIYS----NGTQ-IYAP--KEITV-NPGKIVIRPKETDLLGLVESGSIDYIFIYKSVAKQHNLSYITLPSEINL 256 Pyrococcus furi...
WP_011187806 176 LL---------------------------K-ARKEEWVRPKSVELISLLQSGNMDYAWEYLSVAVQHNLKYLTLDNEVNL 227 Desulfotalea ps...
WP_011341836 177 LL---------------------------A-NRPKENLRDKSVSLTSMVQNGDMDYAWAYRSIALQHHLKFVTLDEHVNL 228 Pelobacter carb...
WP_011838584 184 LLLNKTNIAV-EKVNDTLNLIVP--ADLKVsENSNLIIRSKSVDLISLVEAGTIDYAFEYQSVAVQHHLKYIKLPDQINL 260 Staphylothermus...
3CFX_A       151 LMLANTGMTLtTEENGTALIHVPasEEISP-NTSKIMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPAIDL 229 Methanosarcina ...
3CFZ_A       227 GYYEYADTYKKVALK-IIAKN----KTINAKPIVYGMTVPTNAPHKKEAIEFVKFV 277 Methanocaldococcus jannaschii
WP_011341839 229 GNYQLDDFYKQAKVQ-VTGKKpgtfLTRTGQSVTYGVTLINDAPNKEAAEAFLAYL 283 Pelobacter carbinolicus
WP_010867274 256 KDFSKADFYKKVSIT-LGSt----gKTIYAKPIVYGITVLKDAPNRELALEFLKFL 306 Pyrococcus abyssi
WP_011020338 266 SSLEYADNYSKVQVE-MVNGEv-----VTGSPIVYGVTIPNNAENSELATEFVALL 315 Methanosarcina acetivorans
WP_011418456 231 GNYKEDPYYSQAVVK-VTGKKpgeyMEMKGASTTYGITLIKNAPNQEAAVAFLEYM 285 Syntrophus aciditrophicus
WP_011011192 257 GDFSKEKFYGQISIT-LGSt----gKTIKAKPIVYGVTVLKDAPNREVAIEFLRYL 307 Pyrococcus furiosus
WP_011187806 228 SDYSYNDFYKTAQVE-VSGKKpgvtMTRTGKAITYGITLVKSGENPEAANLFLQYL 282 Desulfotalea psychrophila
WP_011341836 229 AKLAHDDFYGEVSVR-VTGERpgtfIDRKGRFVAYGTTMLKDAPNREAAEAFLAYL 283 Pelobacter carbinolicus
WP_011838584 261 GNPKYAYFYGKVIVKiLVGTDk--eKSIAMSPIIYGITVLDNAPHRSEALKFLKFL 314 Staphylothermus marinus
3CFX_A       230 SSLEYADNYSKVQVE-MVNGEv-----VTGSPIVYGVTIPNNAENSELATEFVALL 279 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap