Conserved Protein Domain Family
glyco_access_1

?
TIGR03728: glyco_access_1 
glycosyltransferase, SP_1767 family
Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
Statistics
?
PSSM-Id: 163440
View PSSM: TIGR03728
Aligned: 12 rows
Threshold Bit Score: 360.457
Threshold Setting Gi: 500159129
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009039958  61 ILMAEETIDYIVKHECSVCRYGDGEIDMI-TclKEGFDesrksdFQTYDEKLAWRLKQILGNGSDEelNLIVCIPY-VWK 138 Bacteroides sp....
WP_012000388  20 VLSIDQSLDYLLENGASVVRFGDGEMDLV-A--GCSIV------YQDFDPELSARLREIMSMESDE--RLMVCLSD-VFT 87  Streptococcus g...
EPT96700       6 VKTISETLDYISKHTASVARFGDGEIDII-A--GNSIP------YQVYDSELAKRLERLLNRQSNE--KLVICVSD-VFD 73  Streptococcus a...
WP_011675801  13 IRSIIETADFIKKNKSSLVRFGDGEIDII-N--HSSIP------YQPYSPELAKQLKNILETQSDE--KCLVALPD-VFQ 80  Lactococcus lactis
WP_001044136 550 VKGIDETLDYIIEHNSSLVRFGDGEINML-A--GHSIP------YQDYDEELVSIMRDIIGQESRE--DLVVCLPD-AFT 617 Streptococcus p...
WP_011162388 403 VKDMDESLNLILQDNKSVIRFGDGEFDLI-R--GASIP------YQTYDSELANRLKDIILRGQFN--NTLVCLPD-VFT 470 Lactobacillus j...
WP_005794519  40 VASIDETIRQIASERCSVSRFGDGEILLTqA--SKNIG------FQKGDPALAERLKEVL-KSHEQ--GHLVCVSD-VFQ 107 Bacteroides fra...
WP_011162389 128 VKSIDETLDEIIENKKSVVRIGDGELDLI-Y--GEDII------YQHFNPELAKILKDSILNNHNP--RVLTCLPD-IFT 195 Lactobacillus j...
WP_011162387 409 VRGMDESLDRLINEKKSIIRFGDGELSLI-N--GKGIT------YQAYNKDLSKKLKQILFAGGNN--KYDVALPD-VFE 476 Lactobacillus j...
WP_012261446  36 VKTLDETLDYIIGNNCSVSRFGDGEFALI-N--GESLI------FQPYSNELKDRLDEII-KSNKV--GHLVCIPN-VFK 102 Bacillus weihen...
WP_011680119  32 VVNLIESMNIIKQ-GVSVSRFGDGEFRIL-TqhGEAIG------FQSHDSYLSVKLEKVL-NEPKN--NHVVALPGpLSR 100 Leuconostoc mes...
WP_011833799   1 -------------------------MNII-A--RNDIG------FQSESLSLSEKMKVVL-NTRDA--TLLISIPN-IFG 42  Methanocorpuscu...
WP_009039958 139 SHRSLSFTARRFIERSFVNNRE-MIFASIHpTRLYG----DSYFTRFYIDARN----KKKK--GSYIQHCRQIWQGRDLC 207 Bacteroides sp....
WP_012000388  88 GLERYSIDAQNFWKVHLYYHLS-DYQEICR-APWYG----STFISRPYIDLED----KTPS--AGYFAKLKQLWQDKDLL 155 Streptococcus g...
EPT96700      74 NLGRYNDFSQQFWRDHLYQYND-LYQKNCQ-AEWYG----STFISRPYMDLLD----KSLS--VTYFEQLKALWKNKDIL 141 Streptococcus a...
WP_011675801  81 NLERYNNSAQNFWKGHFERYHN-FYQELHKsD-WYA----NTFISRPYIDLED----KSSA--AESFEAVRSLWEAKDIL 148 Lactococcus lactis
WP_001044136 618 DRFRFTSWAIPFWKDHMDHYMD-FYRELCS-DSWYG----STFVSRPYIDFED----KSQA--KAQFEKLKSIWENRDLL 685 Streptococcus p...
WP_011162388 471 KPERYQDFTQSFYEKSFFPNNEsFLKEIGQtGNWYG----STFISRPYIDLVD----KSKS--AVYFNKLKQLWSGRDLL 540 Lactobacillus j...
WP_005794519 108 HLERYNRKARRFWRTHFFIYGP-WWDCLLVpGRKYY----NTFVTRPYMDFAS----KQDC--GRWFRDMKAIWEDRDIV 176 Bacteroides fra...
WP_011162389 196 NLDRYNEMRGYYAVGVLPRFSD-FFKEIEKtKYSYG----STFMSRMYMSFKD----KSKS--QHYFHKLRKIWQNKDIL 264 Lactobacillus j...
WP_011162387 477 SLEDYGQYTKDFYETNFFFNNQyLLSEVEKtENIYS----NTFISRPYIDRID----KAKS--AGWFNKLKQIWKEKDIL 546 Lactobacillus j...
WP_012261446 103 DLNWCTEKSRVYWKRYLELNRS-RIYKSISmNKEYY----DALVTRLYIDHQD----KSMA--GIRFDKIKDVWDDREVI 171 Bacillus weihen...
WP_011680119 101 SLFEMNCDARSFWIGALSDDGK-LWKEAMNpDVWNNkkavNTQVTRPYMDYFKinhfKNIA--GTVFHEFKEIWKGKHVL 177 Leuconostoc mes...
WP_011833799  43 SLKSFDIEAEYYWITHREEYYD-LYNSYIDsEYLYG----DALVFRPYICFNK----KERKyvGSYFEQIKSLWYNKEIV 113 Methanocorpuscu...
WP_009039958 208 IIEGEQSRLGVGNDLFDNAQSIERILCPALDAFAKYDEIMKAACTV-----NKAKLVLIALGHTATVLAYDLAEVGYQAI 282 Bacteroides sp....
WP_012000388 156 IVEGLTSRSGVGNDLFDGARSIKRIICPSRNAYSKLEAIKQAVREH-----ADNRLILTMLGPTAKVLVYDLVQEGYRAL 230 Streptococcus g...
EPT96700     142 IVEGETSRSGVGNDLFNDANTISRIICPSKDAFSSFYEIKETILEH-----SRGKLILLMLGPTAKLLAEDLSQLGHQAI 216 Streptococcus a...
WP_011675801 149 IVEGTSSRSGVGNTLFQNAKSISRIICPSHNAYQKYNDILESIKTF-----GMEKLILLMLGPTAKVLGFQLSREGYQAI 223 Lactococcus lactis
WP_001044136 686 IVEGATSRSGVGNDLFDEANSIKRIICPSHSAFSRVHELEQEIEKY-----AGGRLILCMLGPTAKVLSYNLCQMGYQVL 760 Streptococcus p...
WP_011162388 541 IVEGALTRSGVGNDLFTNTKSIKRILAPSKNAYQKIDQIEQMIREN-----AEDRLILLMLGPTAKVVVDDLQDLENQII 615 Lactobacillus j...
WP_005794519 177 FIEGEKSRLGIGNDLFDNVRSIHRILCPPCNAFSRIDDIIAEALKQ-----SKDVLFLIALGPTATVLAYDLFKSGYQAI 251 Bacteroides fra...
WP_011162389 265 IVEGEYTRSGVGNDLFENVRSIQRIICPAEDAYDEVHEIEEAIRNN-----AQNKLILLMLGPTAKVIVNDLQDLDNQIL 339 Lactobacillus j...
WP_011162387 547 IVEGALTRSGVGNDLFDNTKSVKRILAPSRNAYQKVNKIEQMIREN-----AEDRLVLLMLGPTAKVIVDDLQDLDNQLI 621 Lactobacillus j...
WP_012261446 172 VIEGVQSRLGVGNDLFKNVKTIDRIICPSKNAFAKYREILEIAKNQ-----KKSKLILIALGPTATVLAYDLSSYGYQTL 246 Bacillus weihen...
WP_011680119 178 IVEGDKTNFGDGNDLLFGAEKVSKLIVPSKNAFSKYEQILTVTKDIisncdKKNLVVLLAIGPTATVLSYDLANRGAQIL 257 Leuconostoc mes...
WP_011833799 114 IIEGKYTRMGVGNDLFDGAKMIERIICPSSNAYDKYQTILDNALTI-----NKEKLILLSLGPCAKVLGYDMWKLGYHVL 188 Methanocorpuscu...
WP_009039958 283 DIGHIDIEYEWFLMRAPKKVPV-PH-KYVNEVPEGRQFSEERNKEYLSQIIYSVK 335 Bacteroides sp. D22
WP_012000388 231 DIGHIDSEYEWFQMGASHKVKL-SH-KHTAEHNFDQDIEFRDDQAYDSQIVANLA 283 Streptococcus gordonii
EPT96700     217 DLGHIDSEYEWFKMGAVSKVKL-SH-KHTAEHNFDEDITLIEDNSYENQIVSKIG 269 Streptococcus agalactiae BSU165
WP_011675801 224 DIGHIDSEYEWYQMGASYKVKL-QH-KHTAEHNYDTDIIFLQDNDYENSIIGRIE 276 Lactococcus lactis
WP_001044136 761 DVGHIDSEYEWMKMGAKTKVKF-SH-KHTAEHNFDQDIEFIDDETYNSQIVARIl 813 Streptococcus pneumoniae
WP_011162388 616 DLGHIDSEYEWFKMGATHKVKL-EN-KHTAEFNFDENINAVHDKAYENEIIGKIE 668 Lactobacillus johnsonii
WP_005794519 252 DIGHVDIEYEWWRMRARRKVKL-ER-KYVNEVPDGNRVADAGEE-YKRQIIAKIS 303 Bacteroides fragilis
WP_011162389 340 DIGHIDTKYEWFKMDAKYVVSIgKN-KHMAE-SVDKNLNEEDNPQYQKEIIMKIN 392 Lactobacillus johnsonii
WP_011162387 622 DLGHIDSEYEWFKMGATYKVKL-KN-KHTAEFNFDENIEAVHDQTYENEIIGKIE 674 Lactobacillus johnsonii
WP_012261446 247 DIGHIDVEYEWFLKKATEKQPV-KN-KYIGEVDNGTNVNAISDLKYESEIIARVI 299 Bacillus weihenstephanensis
WP_011680119 258 DVGHLDVEYQWYLLNAKKKIAL-NN-KAVNEVNDINYDNITVDNQF--EIVGRIE 308 Leuconostoc mesenteroides
WP_011833799 189 DIGHIDSEYEWYLHNVEWKKRM-NNnKHYADIVDLENIVECQDVSYNSQILMDIS 242 Methanocorpusculum labreanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap