Conserved Protein Domain Family
R_switched_YjbE

?
TIGR03717: R_switched_YjbE 
integral membrane protein, YjbE family
Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.
Statistics
?
PSSM-Id: 163429
View PSSM: TIGR03717
Aligned: 29 rows
Threshold Bit Score: 163.488
Threshold Setting Gi: 499449398
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010909429  11 ALFQVIAIDLALAGDNAIVIGLAAAGLPAAQRKRAILVGIAAATVLRIFFALITQWLLTIgPMLLIAGGLLLLWVCWKMW 90  Mesorhizobium loti
EQB97452      10 ALWKIIAIDIILSGDNAVVIAMATRRLPKDQRNKAIFWGTAGAVLLRILFAAIIVFLLNI-PFVHFVGGLLLVWIAYKVL 88  Geobacillus sp. A8
WP_010971969  11 AFLQVIAIDLVLAGDNAIVIGLAAAGLPAHLRRKAILVGIIAATVLRIGFAAVTVQLLAI-GGLQLFGGLMLAWVCWKMW 89  Agrobacterium f...
WP_011563911   9 kLGGLLFVNLILSGDNAVVIAMASRRLKGSLRRKAIVWGAAGAVGLRMVFAAAVTFLLSI-PFLRALGGALLCWISWGLV 87  Rubrobacter xyl...
WP_011565941  11 rFLGVLMIDLILSGDNAVVIALAVRQLHGKTRKRAIFWGAFGAVALRLIFAAVITYLLRI-PLLQAIGAVLLVWIAWKLL 89  Rubrobacter xyl...
KCV33929      40 ALLQIIWVNILLSGDNAVVIALAARSLPPDQQKKAIVVGSAAAIVMRIVLTLVAAKLLLL-PWLKLIGAALLVYIGVSLL 118 Bordetella bron...
WP_011501830  15 ALAQVIMIDLVLAGDNAVVIGLAAAGLPKEQRGKAILIGIIAATVLRILFASVTVQLLQI-LGLLLAGGVLLLWVCWKMW 93  Rhodopseudomona...
WP_010919117  18 ALLQVLMIDLVLAGDNAVAVGLAAGGLPAKERKKVILYGLGAAVLLRITFALITTWLLGV-VGLLLAGGFLLLWVCWKMW 96  Caulobacter vib...
WP_006997061  13 ILGQIIFIDLVLAGDNAIIIGMVASKFPPEQRKKVIFWGIGGAVILRIILTMLTAYLLQI-TGLRLIGGLLLLYIVYKLY 91  Candidatus Pela...
WP_011000515  11 ALGSIILTNIVLSGDNAVVIALAARNLPRRQQRQAIFWGSAAAIALRIALTVLAVKLLAL-PYLKTIGAVLLVYIGIKLL 89  Ralstonia solan...
WP_010909429  91 RELRVSHDEER-----------------DAT---EalsngdfdkdgvvggkgsgkTFSQAAWQIVIADVSMSLDNVLAVA 150 Mesorhizobium loti
EQB97452      89 VEREEEAN--V-----------------QSS---D--------------------RLLKAIATIIIADAVMSLDNVVAVA 126 Geobacillus sp. A8
WP_010971969  90 TELREAAGSIEdevtde------eadltKGH---K--------------------TFFQAATQIVIADVSMSLDNVLAVA 140 Agrobacterium f...
WP_011563911  88 QEEDGDEEGKV-----------------PGG---Gaaeg-------------sgrGVWDAVKIIVLADAVMSLDNVIALV 134 Rubrobacter xyl...
WP_011565941  90 FQDHEEPEEDV-----------------EAA---G--------------------NIWEAIRIIIAADAIMSLDNVVALV 129 Rubrobacter xyl...
KCV33929     119 LPEGEDDGAE------------------KGH---G--------------------SLFVAIRTIMIADLVMSLDNVVAVA 157 Bordetella bron...
WP_011501830  94 RELRTQHPDDD-----------------DVS---Edasriga------ssagptkTLGQAVWQITLADVSMSLDNVLAVA 147 Rhodopseudomona...
WP_010919117  97 RELREQTTHDEadamamidddpstepraRPN---K--------------------TFKAAFLQVLIADVSMSLDNVLAVA 153 Caulobacter vib...
WP_006997061  92 TDVIKGQSGDE-----------------DIKvdnS--------------------SFMKAIWTVLLADFTMSLDNVLGVA 134 Candidatus Pela...
WP_011000515  90 SEAEDEAAGEH-----------------RPH---D--------------------GLWPAIRTILIADLVMSLDNVVAVA 129 Ralstonia solan...
WP_010909429 151 -----GAAMNHPTVLVIGLALSIALMGFAASFVARLLHKYRWIAYIGLAIILYVAVKMLLDG 207 Mesorhizobium loti
EQB97452     127 -----GAAEGHLGMLALGVAISIPIMIFGSKAIVRVMEQHRWIAYVGSGILAWTAGKMMAGD 183 Geobacillus sp. A8
WP_010971969 141 -----GAAQEHVTVLIIGLIVSIALMGLAANFVAKLLHRYRWISYLGLIVIIYVALNMLYHG 197 Agrobacterium fabrum
WP_011563911 135 -----GIAGGNLWLLGVGLLISIPLVIWGSTLLSALLERLPILVYAGAALLVYVAVEMLFED 191 Rubrobacter xylanophilus
WP_011565941 130 -----GVSGGNLWLLVFGLALTIPLIVWGSTILSALMDRLPWLVYVGSGVLIYVAVEMFFKD 186 Rubrobacter xylanophilus
KCV33929     158 -----AAAMGDTTLLVLGLAISIPLVIFGSALLLKVIERFPIIVWVGAALLGFIAGELLVGD 214 Bordetella bronchiseptica 00-P-2796
WP_011501830 148 -----GAAREHPIILIFGLGLSIALMGLAATVIAKLLQKHRWIAYVGLVIILYVALDMIYRG 204 Rhodopseudomonas palustris
WP_010919117 154 -----GAAREHPGILIFGLLLSIVLMGVAATAIANLLHKHRWIGFVGLAIVLYVAAHMIWTG 210 Caulobacter vibrioides
WP_006997061 135 -----GAAGDHYVLLIFGLALSIILMATAATVISRWINEYKWIAWIGLIAILVVAIELIYTD 191 Candidatus Pelagibacter ubique
WP_011000515 130 aaaekGPPGTDVALLVLGLGLSIPLIIFGSTLLVALMVRLPLIVTLAAALLGYLAGDMLVTD 191 Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap