Conserved Protein Domain Family
secA2

?
TIGR03714: secA2 
accessory Sec system translocase SecA2
Members of this protein family are homologous to SecA and part of the accessory Sec system. This system, including both five core proteins for export and a variable number of proteins for glycosylation, operates in certain Gram-positive pathogens for the maturation and delivery of serine-rich glycoproteins such as the cell surface glycoprotein GspB in Streptococcus gordonii. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 163426
View PSSM: TIGR03714
Aligned: 10 rows
Threshold Bit Score: 1237.22
Threshold Setting Gi: 81703889
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FDL0     9 INELRLKSIRKIVKRINTWSDEVKSYSDDALKQKTIEFKERLASGVdTLDTLLPEAYAVAREASWRVLGMYPKEVQLIGA 88  Staphylococcus aure...
Q97P83     6 GQDFQLRKVKKILKQINALKGKMSSLSDQELVAKTVEFRQRLSEGE-SLDDILVEAFAVVREADKRILGMFPYDVQVMGA 84  Streptococcus pneum...
A3CM59     3 KNHFQIQRLKKILAKVKSFESEMAGLTDAELRKKTQEFKERLAAGE-TLDDLLPEAYAVVREADKRVLGMFPYDVQVMGA 81  Streptococcus sangu...
Q8E484    10 LDKKRLKKLQRTLNTINSLKGQMATLSNEELQAKTTEFRKRLVNGE-TLDDICAEAFAVVREADKRVLGLFPYDVQVIGG 88  Streptococcus agala...
AAZ95531  13 LNKLRLQRIQKIVNEINNKKVYYAQLSDKELSHQTLILKNRLSSGE-SLDDILVDAFAVIREANKRILGLFPYDAQVMGA 91  Streptococcus agala...
ABL74003  11 INTMKLRRLRKKLVKINALKETMSLLSDEELKQKTVEFRNRLHEGE-TLEDILIEAFAAIREADRRILGMFPFDVQVLGA 89  Streptococcus paras...
Q03HZ9     5 LDNFRLRKYSKITKKILALGKKYQTLTDDQLRIKTETLRNKLVKGA-SLDSILIEAYATIREADFRVLGLKPFENQVLGA 83  Pediococcus pentosa...
Q5HKR6     9 INNIRLRKLRKILNQINALSEEFSNFSDEALQAKTKEFKVYLNDNKaSLNHILPQAYATVREASKRVLGMYPKDVQILGA 88  Staphylococcus epid...
Q4L9N5     9 INSMRLKRLQKQLVAVNRLSDQMRNCSDEALQAKTADFKQRLEKREtTLDKLLPEAYATIREASKRVLGMYPKDVQVMGA 88  Staphylococcus haem...
Q74L37     3 TDRLRLKKARKLLNKINKLGPKMQAMSDEKLQGQTAIFKKQLKEGK-SLDDILPEAYATVREADKRILGMFPYDVQVLGA 81  Lactobacillus johns...
Q2FDL0    89 IVLHEGNIAEMQTGEGKTLTATMPLYLNALSGKGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVD--IVDYEYQKG 166 Staphylococcus aure...
Q97P83    85 IVMHYGNVAEMNTGEGKTLTATMPVYLNAFSGEGVMVVTPNEYLSKRDAEEMGQVYRFLGLTIGVPFTE--DPKKEMKAE 162 Streptococcus pneum...
A3CM59    82 IVLHEGNVAEMATGEGKTLTATMPLYLNALSGQGAMLVTTNTYLALRDAQEMGQVYRFLGLTIEAAVVA--DETENLTPK 159 Streptococcus sangu...
Q8E484    89 LVLHQGNTAEMKTGEGKTLTATMPLYLNALEGKGAMLLTNNSYLAIRDAEEMGKVYRFLGLSVGVGVSD--NEEEDRDAA 166 Streptococcus agala...
AAZ95531  92 IALHQGTIAEMKTGEGKTLTATMPLYLNALTSKGAILVTTNDYLAKRDALEMGKVYQFLGMTVGINVFD---KKEEADAT 168 Streptococcus agala...
ABL74003  90 LALHEGTIVEMKTGEGKTLTATLPLYLNALEGKGTILVTTNDYLARRDAIDMGEVYRFMGLTVGVGVFD---DDEEVDSN 166 Streptococcus paras...
Q03HZ9    84 VVLHYGNVAQMNTGEGKTLTATMPLYLNGLTGPGNFLVTVNSYLANRDAEEIGKVYKWMGLTCASGVSL---DDEELD-- 158 Pediococcus pentosa...
Q5HKR6    89 IAMHQGNIAEMQTGEGKTLTATMPLYLNALTGKGAYLITTNDYLAKRDFLEMKPLYEWLGLSVSLGFVD--IPEYEYAEN 166 Staphylococcus epid...
Q4L9N5    89 IVMHQGNIAEMQTGEGKTLTATMPLYLNALTGKSAFLITTNDYLANRDFQEMRPLYEWLGLTASLGFVD--IPDYEYAEN 166 Staphylococcus haem...
Q74L37    82 IVLHNGSIAEMKTGEGKTLVATMALYLNALEGKGAMLVTPNGYLASRDKKELAPVYEWLGLSVSLAFAEekDSKKKITAK 161 Lactobacillus johns...
Q2FDL0   167 EKRNIYEHDIIYTTNGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDAAQTPLVISGAPRLQSNLFHIVKEFVD 246 Staphylococcus aure...
Q97P83   163 EKKLIYASDIIYTTNSNLGFDYLNDNLASNEEGKFLRPFNYVIIDEIDDILLDSAQTPLIIAGSPRVQSNYYAIIDTLVT 242 Streptococcus pneum...
A3CM59   160 QKRLIYQADIVYTTNSALGFDYLIENLAENKDSQYLSPFNYVIIDEIDSILLDSAQVPLVISGAPRVQSNFYSIMDTFIT 239 Streptococcus sangu...
Q8E484   167 TKRAVYSSDIVYSTSSALGFDYLIDNLASSKSQKYMPKLHYAIVDEADAVLLDMAQTPLVISGSPRVQSNLYKIADELIL 246 Streptococcus agala...
AAZ95531 169 IKREVYESDITYTTAGALGFDYLVHNLASNKLEQFLRPFHFVIVDEADSVLLDIAQTPLIIAGDPRVQSNLYGITNNFVL 248 Streptococcus agala...
ABL74003 167 RKKKIYSSDILYTTSTALGFDYLIDNLAGNVEDKFLRSFNYVIVDEADAVLLDSAQTPLIIAGSPRVQSNLYDTADQFIR 246 Streptococcus paras...
Q03HZ9   159 -KKAIYQNDIVYTTNSELGFDYLTDNLVDNINKKKLNDLNFALVDEVDSVLLDLAQTPLVISGAPRVQSNLFVSTDRIVK 237 Pediococcus pentosa...
Q5HKR6   167 EKYELYHHDIVYTTNGRLGFDYLIDNLADDIRAKFLPKLNFAIIDEVDSIILDAAQTPLVISGAPRVQSNLFHIVKTFVE 246 Staphylococcus epid...
Q4L9N5   167 EKQMLYNHDIIYTTNGRLGFDYLFDNLADHINAKYLPELNFAIIDEVDSIILDAAQTPLVISGAPRVQSNLFHIIKMFVE 246 Staphylococcus haem...
Q74L37   162 TKRKWYNSDIVYTTASSLAFDYLFNNLASSKENQYLRPFNYVIVDEVDEVLLDEAQTPFVVSSSPNVQSNLYHLADQFVR 241 Lactobacillus johns...
Q2FDL0   247 TLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVEDLYSEQAMVLVRNINLALRAQYLFESNVDYFVY----NGDIVLIDR 322 Staphylococcus aure...
Q97P83   243 TLVEGEDYIFKEEKEEVWLTTKGAKSAENFLGIDNLYKEEHASFARHLVYAIRAHKLFTKDKDYIIR----GNEMVLVDK 318 Streptococcus pneum...
A3CM59   240 TLKEEEDYHYDDEKNEVWLTSKGILAAESFLDLEHLFSKENQELVRHLNLALRAHKLYKKDKDYVVRqgdkEAEVVLLDR 319 Streptococcus sangu...
Q8E484   247 SFEEQVDYYFDKERQEVWIKNQGVREAERYFRIPHFYKQSNRELVRHLNLSLKAHKLFERGKDYVVD----DGEIKLLDA 322 Streptococcus agala...
AAZ95531 249 TLKENDEYIHKAKDKIVYLTEKGVSYAKQYFNISELYNDEYWELNRHINLALRAHCLYKRDYDYVVK----NNEVKLLDN 324 Streptococcus agala...
ABL74003 247 TLKKDQEFKFLKDEKFIFLTDEGIRYAEKYFNIPNLYSEEYFELNRHINLALRAHYLFKKDMDYVVT----DDAVELLDN 322 Streptococcus paras...
Q03HZ9   238 SLKPNVDFEFSEDLKDVWFTQTGIEQLEEYLGIQGLISDKWSDFYRHLVLALKANYVMKRNQDYIVT----NREVLLLDS 313 Pediococcus pentosa...
Q5HKR6   247 TLEKDKDFIVNFNKKEVWLTDEGSEKASHYFKVNSIYQQQYFDLVRMIHLSLRAKYLFKYNLDYFIF----DGEIVLIDR 322 Staphylococcus epid...
Q4L9N5   247 TLVEDEHFKLNVNKKEVWLTDEGIDVANHYFKVNNIYLPQYFDLVRVINLSLRAKYLFKDNLDYFIY----NGEVVLIDR 322 Staphylococcus haem...
Q74L37   242 LLDPEVDYVFKKDDQLFWLTAHGIEKAEQFFKLDSLFSNESRSVYRHIILAMGAHLTMRRGHDYLVV----KGEVVLLDE 317 Lactobacillus johns...
Q2FDL0   323 ITGRMLPGTKLQAGLHQAIEAKEGMEVSTDKSVMATITFQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDKAI 402 Staphylococcus aure...
Q97P83   319 GTGRLMEMTKLQGGLHQAIEAKEHVKLSPETRAMASITYQSLFKMFNKISGMTGTGKVAEKEFIETYNMSVVRIPTNRPR 398 Streptococcus pneum...
A3CM59   320 ATGRLLEMTRLQGGQHQAIEAKEHVKLTEETRAMASITYQNLFRLFRKISGMTGTGKVVESEFMETYSMSVIKIPTNQPV 399 Streptococcus sangu...
Q8E484   323 TNGRVLEGTKLQGGVHQAIEQKEHLNVTPESRAMASITYQNLFRMFTKLAGMTGTGKTAEKEFIEVYDMEVVRIPTNSPV 402 Streptococcus agala...
AAZ95531 325 ATGRVMEGTKLQSGIHQAIEAKEDVALTNESRAIASITYQSLFNMFPRLSGMTGTGKSSEDELIKTYHLPVIVIPTNFPI 404 Streptococcus agala...
ABL74003 323 RTGRILEGTRLQSGIHQAIETKEKVKKSKDSRAIASVTYQSLFNMFPKLSGMTGTGKIAENELISTYGVSVVVLPTNTPI 402 Streptococcus paras...
Q03HZ9   314 ENGRALTGMKLEAGIHQAIEAKEEVELSDQTRSMASITLQNFFKMFRKLSGMTGTAKSSAREFLEVYNLPVLKIPTHKPN 393 Pediococcus pentosa...
Q5HKR6   323 ITGRMLPGTKLQSGLHQAIEALENVEISQDMSVMATITFQNLFKQFDEFSGMTGTGKLGEKEFFDLYSKVVIEIPTHSPI 402 Staphylococcus epid...
Q4L9N5   323 ITGRMLPGTKLQSGLHQAIEAKEGVELSQDLSVMATITFQNLFKLFNGFSGMTGTGKLGEKEFFDLYSKLVVEIPTNHPI 402 Staphylococcus haem...
Q74L37   318 DSGRLKRGVQVSTGIHQAVEAKEKVELTKIQKTAASITFPALFALFNKVSGMSGTAKVNEEEFLQTYNLKVVTIPTRVPV 397 Lactobacillus johns...
Q2FDL0   403 QRIDEPDKVFRSVDEKNIAMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPNNLLIAQNVAKEAQMIAEAGQIG 482 Staphylococcus aure...
Q97P83   399 QRIDYPDNLYITLPEKVYASLEYIKQYHAKGNPLLVFVGSVEMSQLYSSLLFREGIAHNVLNANNAAREAQIISESGQMG 478 Streptococcus pneum...
A3CM59   400 IRQDLPDQLYQTLPEKVFASLDEVKHYHAQGNPLLIFTGSVEMSEIYSSLLLREGIAHNLLNANNAAREAQIIAESGQKG 479 Streptococcus sangu...
Q8E484   403 RRIDYPDKIYTTLPEKIHATIEFVKQVHDTGQPILLVAGSVRMSELFSELLLLSGIPHSLLNAQSAVKEAQMIAEAGQKG 482 Streptococcus agala...
AAZ95531 405 KRVDLADKIYVSLPEKLQATIDDVKQRHSKGQPVLLISGTVEIANIYSKLLLREGIAHNTLTADNVVKEAQIIKEAGQKG 484 Streptococcus agala...
ABL74003 403 QRLDYSDKIYTTLPEKLLATLEFVKELHEKQQPILLISGTVDIAEIYSRMLLQEGIPHNVLTAKNIAKEALIIAEAGQKG 482 Streptococcus paras...
Q03HZ9   394 IRIDHADVVFATMDEKIEATVRMVKAAYQIKRPVLLKTGSLSLSRLYSRVLLEHGIVHNVLNAQSESKEAMIVASAGKSG 473 Pediococcus pentosa...
Q5HKR6   403 ERDDRPDRVFANGDKKNDAILKTVIGIHETQQPVLLITRTAEAAEYFSAELFKRDIPNNLLIAQNVAKEAQMIAEAGQLS 482 Staphylococcus epid...
Q4L9N5   403 IRNDKEDRVYAKSDEKNKAILEKVKEIHATKQPVLLITRTAEAAEYFSTQLFKDNIPNNLLIAQNVAKEAQMIAEAGQLG 482 Staphylococcus haem...
Q74L37   398 IRKDYRPLIFLTTIDKLMTAVDDVVEMHKTGRPVLLVAGSVENSEIISELLLNIGIPHNVLNAYNAAYEAQIIKNAGQKN 477 Lactobacillus johns...
Q2FDL0   483 SMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENSRVDRQLRGRSGRQGDPGSSCIYISLDDYLVKRWSDSNLAENN 562 Staphylococcus aure...
Q97P83   479 AVTVATSMAGRGTDIKLGKGVAELGGLIVIGTERMESQRIDLQIRGRSGRQGDPGMSKFFVSLEDDVIKKFGPSWVHKKY 558 Streptococcus pneum...
A3CM59   480 AVTVATSMAGRGTDIKLGPGVADLGGLVVIGTERMENQRIDLQIRGRSGRQGDPGISKFFISLEDDLLRKWGPDWLKKLY 559 Streptococcus sangu...
Q8E484   483 AVTVATNMAGRGTDIKLGKGVSELGGLAVIGTERMKSQRMDLQLRGRSGRQGDIGFSQFFVSFEDDLMIESGPKWAQDYF 562 Streptococcus agala...
AAZ95531 485 SVTCATVLAGRGTDIKLGEGVRELGGLAVIGTERMPNLRMDWQLRGRSGRQGDPGISQFYVSLEDELIVSHSPEWVIKYL 564 Streptococcus agala...
ABL74003 483 AVTVATSLAGRGTDIKLGKGVAELGGLAVIGTERMPNSRIDWQLRGRAGRQGDPGLSQFFVSLEDDLIMNHANRRLKKYF 562 Streptococcus paras...
Q03HZ9   474 AITVATSMAGRGTDIKLGKGVKEKGGLLVIGTERMDSRRVDDQLRGRAGRQGDPGESIFLVSLDDKVVIENAPDWVEKYR 553 Pediococcus pentosa...
Q5HKR6   483 AVTVATSMAGRGTDIKLSKEVHDIGGLAVIINEHMDNSRVDRQLRGRSGRQGDPGYSQIFVSLDDDLVKRWSNSNLAENK 562 Staphylococcus epid...
Q4L9N5   483 AVTVSTSMAGRGTDIKLGSGVYELGGLAVIINEHMENSRVDRQLRGRSGRQGDPGVSQIYVSLDDYIVKRWSNSKLAENK 562 Staphylococcus haem...
Q74L37   478 AVTIATNMAGRGTDIKLGPGVKELGGLAVIGTEMLPK-RVELQLAGRAGRQGDPGSSQFLISLEDSFISSNNTPRQKKYY 556 Lactobacillus johns...
Q2FDL0   563 QLYS--LDAQRlSQSNLFNRKV-KQIVVKAQRISEEQGVKAREMANEFEKSISIQRDLVYEERNRVLEIDDAENQDFKAL 639 Staphylococcus aure...
Q97P83   559 KDYQ--VQDMT-QPEVLKGRKY-RKLVEKAQHASDSAGRSARRQTLEYAESMNIQRDIVYKERNRLIDGSRDLEDVVVDI 634 Streptococcus pneum...
A3CM59   560 KDYS--TEEVQqHPVQLGQRRF-RRLVAKAQRASESSAKMSRRMTLEYAQCMKIQREITYAERNRLIQAEERIDEEISRV 636 Streptococcus sangu...
Q8E484   563 RKNR--DKVNPeKPKALGQRRF-QKLFQQTQEASDGKGESARSQTIEFDSSVQLQREYVYRERNALINGES-GHFSPRQI 638 Streptococcus agala...
AAZ95531 565 KKYS--RKETSnYYMVPRKKRFfYQIVKNAQLRSEDKGVSSREQTIKFGESLRIQRENIYQLRNELIADSSIVVDGVIKI 642 Streptococcus agala...
ABL74003 563 EKQN--SIDRKnYGKPLFSKRF-SRIVTHAQQKSEDKSESARQNTIKFDESLKSQRKKIYHLRDQLIFGEVKLRDRLDKL 639 Streptococcus paras...
Q03HZ9   554 LKLEqaVEQGKrKYGAPLKGRRaRKIVEKAQQAADSAAEESRKNAVKMDDILRIQRELIYDFRDYIMKSTD-LTTMVQQI 632 Pediococcus pentosa...
Q5HKR6   563 NLQT--MDASKlESSALFKKRV-KSIVNKAQRVSEETAMKNREMANEFEKSISVQRDKIYAERNHILEASDFDDFNFEQL 639 Staphylococcus epid...
Q4L9N5   563 KLKD--VDPDKlQDSPFFRRRV-RGIVSKAQRVSEETSMMAREMANEFEKSIGIQRDRVYEERNRILETSDFSAFDFDSL 639 Staphylococcus haem...
Q74L37   557 RKLM--KKKSKgKDITLLSGPRiRFSLLMLRTRKEDLNELMRSQTNKMEIILSLQRKNFYTRRDKIMKTDD-LQEDVDRI 633 Lactobacillus johns...
Q2FDL0   640 AKDVFEMFVN--EEkV-LTKSRVV---EYIYQNLSFQ-FNKDVACVNFKDKQAVVTFLLEQFEKQLALNRKNMQSAYYYN 712 Staphylococcus aure...
Q97P83   635 IERYTEEVAA--DH-Y-ASRELLF---HFIVTNISFH-VKEVPDYIDVTDKTAVRSFMKQVIDKELSEKKELLNQHDLYE 706 Streptococcus pneum...
A3CM59   637 LSQVIHQAAY--EQsY-ETRADLY---RFILDHFSYH-AERIPYDFDIYSPEKIAELLQDIAEQELQAKKAYLKSDKLFT 709 Streptococcus sangu...
Q8E484   639 IDTVISSFIAylDGeV-EKEELIFevnRFIFDNMSYN-LQGISKEMSL---EEIKNYLFKIADEILREKHNLLGDS--FG 711 Streptococcus agala...
AAZ95531 643 IQDNFNDIAN--DKdL-TEHSLR----RYILENLTYK-FKYFPDEFDVHNSDDVFKLLIDIFDREFTAKKTKLQSDNEFD 714 Streptococcus agala...
ABL74003 640 ISEYIEMYMEn-NRkFgLNQNDFK---RFILENFTYQ-LRSLPKSLDLSNSRQVKDYLFYLYQLEMERKSKQLKTDSKVE 714 Streptococcus paras...
Q03HZ9   633 KNDYFNAIAR--ENkK-DAGKLL----DFIINNVDYNyMDNDFNPEILESTADIKQYLEEIARNRWSQQQMIVNNKFKQN 705 Pediococcus pentosa...
Q5HKR6   640 ARDVFTKDVK--NLdL-SSERALV---NYIYENLSFV-FDEDVSNINMQNDEEIIQFLIQQFTQQFNNRLEVAADSYLKL 712 Staphylococcus epid...
Q4L9N5   640 ARDVFDYDLR--TKhI-HNKDDII---NYIYEQLSFS-FKDDAISQQIQTREQTIDYLVQQFNKQLKENMKIANNDYFKL 712 Staphylococcus haem...
Q74L37   634 IDNALNLYLE--KQdL-SNKSDLK---YFINQHVTYQ-QVNVPD--NLKTKKAIKDFLKELAYKILDEKKHVLINKKQAN 704 Lactobacillus johns...
Q2FDL0   713 IFVQKVFLKAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVALDSFEVMTRNIK 771 Staphylococcus aureus subsp. aureus USA300
Q97P83   707 QFLRLSLLKAIDDNWVEQVDYLQQLSMAIGGQSASQKNPIVEYYQEAYAGFEAMKEQIH 765 Streptococcus pneumoniae TIGR4
A3CM59   710 HFQRVSVLKAIDENWVEQVDYLQQLKTALSGQHFSMKNPLVEYYQEAYDGFEYMKERMK 768 Streptococcus sanguinis SK36
Q8E484   712 DFERTAALKAIDEAWIEEVDYLQQLRTVATARQTAQRNPVFEYHKEAYKSYNIMKKEIR 770 Streptococcus agalactiae NEM316
AAZ95531 715 NFVRISILKAIDKSWIEEVDSLQQLKGVVTNRGIGQRDIIQEYYKESLNSYYKMGKEIR 773 Streptococcus agalactiae
ABL74003 715 EFIRLSILRAIDECWIQQVDHLQQLKTFVSMRQIAQRDSFNEYLRESLESYEEMSREVK 773 Streptococcus parasanguinis
Q03HZ9   706 YLERLAVLKALDVAWIEQVDNLQQLKTVVTSRSSGQHNPVFEYEKEAMHSFEQMKKLFW 764 Pediococcus pentosaceus ATCC 25745
Q5HKR6   713 RFIQKSILKAIDSEWIEQVDNLQQLKASVNNRQNGQRNVIFEYHKVALETYEYMSEDIK 771 Staphylococcus epidermidis RP62A
Q4L9N5   713 RFFQKAILKAIDVEWINQVDQLQQLKASVNNRQNGQRNAIFEYHKVALETYEMMLINIK 771 Staphylococcus haemolyticus JCSC1435
Q74L37   705 DFYQQVIISSMDGNWIDQVDRIEKIKINAQQWGRSGRPQDLLHQEKAFEAYKDFLDKIT 763 Lactobacillus johnsonii NCC 533
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap