Conserved Protein Domain Family
acc_sec_asp3

?
TIGR03711: acc_sec_asp3 
accessory Sec system protein Asp3
This protein is designated Asp3 because, along with SecY2, SecA2, and other proteins it is part of the accessory Sec system. The system is involved in the export of serine-rich glycoproteins important for virulence in a number of Gram-positive species, including Streptococcus gordonii and Staphylococcus aureus. This protein family is assigned to transport rather than glycosylation function, but the specific molecular role is unknown. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 163423
View PSSM: TIGR03711
Aligned: 8 rows
Threshold Bit Score: 192.195
Threshold Setting Gi: 446026547
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011679031   3 YQIYWTPNTeLLGLQGATVDFRSLNEVYYENYFLPSGEVVARWHSTYNRMSGQPVvkADLPQLSHGETYVIERHIDASDR 82  Leuconostoc mes...
WP_012000393   4 ASISNTRKD-FTYLYGSTIIFHSPDQVYFENKLMASGQTIHEWSSSWNYQGDRQV--PSLPLLKRGRSYSLTRDMNSYPS 80  Streptococcus g...
WP_000916729   7 FKVTWNYISqTTFMYGSKVSFSN-GEVTFINPLMPSGLPIHEWLMLKQFSKYKSA--PSLPILRRGQHYKLHFDFDATPA 83  Staphylococcus ...
WP_011274658   7 YTLTWRHINtTTFMYGTKLRI-EDDGTYFNNPLMPSGTVIHDWRMLTTFSEHKYA--PSLPILKKKQQYKVILNYNVEPL 83  Staphylococcus ...
WP_000587540   7 QSIHWGEVG-GTYMYGTTVSYYPDKSVRLYNPLLPSGEILKTWFSSVNYQAARTQ--PQLPLLKRKQEYQLSLVFDCQPE 83  Streptococcus p...
AAZ95530      14 QKVLWTDSS-NVYLYGSTIKYLEHNRVFFENLRFSTGKTIKKWLSKTNFQANRTL--PELTLLKPNHTYELVSKLTTVPE 90  Streptococcus a...
WP_000104402   5 SYIYWDDFSrFSYNFGTKLQFLG-KSVCFENPLAPSSTNLYTWSSQTNYQSKRIS--PNLPLLRKGTRYSLSLNAELDLV 81  Streptococcus a...
WP_011161546   6 NQVYWDRMSe-TYLYGTAFKKNAKNEVTFKNKLMPSGKTLISWSSIANYQAAKEV--PSLPLLLNGQEYLLKISAKIKPE 82  Lactobacillus j...
WP_011679031  83 MFAYLVVTFFDQQYQPIATFSENTERLLINTPDEYAFYVIDLVSAGSGHFTFHNFDI 139 Leuconostoc mesenteroides
WP_012000393  81 GSVFLKLIFFDRYNREVGNIVERSDKMAFTYPEEAYSYKVQLLSAGVESFEFHYLKI 137 Streptococcus gordonii
WP_000916729  84 GSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYAYKIKMMNAASTSLIFRCLTI 140 Staphylococcus aureus
WP_011274658  84 GSVYIKITFYRKNDTEHSNLIIQNSDAEFEFPEEAYAYKIELINAGLSELFFKNIII 140 Staphylococcus haemolyticus
WP_000587540  84 NGVYTKITFFDRYGDILEKKVEKVKDFIFTYPEDSYTYRVSLLSAGFESLTFYHFSI 140 Streptococcus pneumoniae
AAZ95530      91 GCVIIQINFYNRQKEKIGFSIIRDHSSDFIVPDDTYFYDISLIGAGCISVEFCYLEL 147 Streptococcus agalactiae
WP_000104402  82 SSLFVRIEFYNRFNESVGFELLKKDSIIFIYPKEAYTYTISLINAGCSDFTFHYLKL 138 Streptococcus agalactiae
WP_011161546  83 NSAIFGIHFFDIQGNEIDKVIFTDLEHKFKYPPRAVKYTIEIISGGVEEINFKKIQI 139 Lactobacillus johnsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap