2P1R


Conserved Protein Domain Family
lip_kinase_YegS

?
TIGR03702: lip_kinase_YegS 
Click on image for an interactive view with Cn3D
lipid kinase YegS
Members of this protein family are designated YegS, an apparent lipid kinase family in the Proteobacteria. Bakali, et al. report phosphatidylglycerol kinase activity for the member from Escherichia coli, but refrain from calling that activity synonymous with its biological role. Note that a broader, subfamily-type model (TIGR00147), includes this family but also multiple paralogs in some species and varied functions. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 163414
View PSSM: TIGR03702
Aligned: 7 rows
Threshold Bit Score: 433.768
Threshold Setting Gi: 685982337
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P1R_A         6 ASLLILNGKSADNQPLREAITLLRDEGIQIHVRVTWEKGDAQRYVDEARRLGVETVIAGGGDGTINEVSTALIQIRDGVA 85  Salmonella ente...
WP_002209799   3 HTLLILNGKESGNPEVREAVKNVRDEGLTLHVRITWEHGDAKRYVEEAATLAVSTVIAGGGDGTINEVATALMSLPADKR 82  Yersinia
WP_001273389   6 ASLLILNGKSADNQPLREAITLLRDEGIQIHVRVTWEKGDAQRYVDEARRLGVETVIAGGGDGTINEVSTALIQIRDGVA 85  Salmonella ente...
WP_011587774  18 KALLILHGKQADNQSVRNAVIDWRNQGHELAVRVTWEGGDAERYVREALDNGFKTIIAGGGDGSVRDITQALMENGNSEL 97  Alcanivorax bor...
AAN67738      58 KAMLVLHGKQAMNEDVRSAVGDLRDSGWVLDVRVTWEAGDAQRLVAEALAAGYSHIVAGGGDGTLRDVAEAMGLAATQAS 137 Pseudomonas put...
WP_031689670   5 KVLLVLHGKQAGNEEVRAAVAAQREAGRELAVRVTWEDGDARRIVEEALAAGYATLVAGGGDGTLREVAEALARGRGEAS 84  Pseudomonas aer...
WP_012437190  37 HWRLILNGKSTDNEDLREAVGVLRKRGIQLDVRVTWEEGDAERYVAEAIADGVQTVVAAGGDGTLSEVAAALAHHQDDAA 116 Xanthomonas cam...
2P1R_A        86 --PALGLLPLGTANDFATSAGIPEALDKALKLAIAGNAXEIDXAXVN---DKTCFINXATGGFGTRITTETPEKLKAALG 160 Salmonella ente...
WP_002209799  83 --PCLGILPLGTANDFATGCNIPLQIENALQLAVKGRAVAIDLAQVN---GEHYFINMATGGFGTRITTETPDKLKAALG 157 Yersinia
WP_001273389  86 --PALGLLPLGTANDFATSAGIPEALDKALKLAIAGNAMEIDMAMVN---DKTCFINMATGGFGTRITTETPEKLKAALG 160 Salmonella ente...
WP_011587774  98 ---ELAIIPLGTANDFATAAEVSEEPADALSL-LNRPAQPCDVIRVN----NHYFLNMATGGFGTEVTTQTSEELKKMLG 169 Alcanivorax bor...
AAN67738     138 ----LALLPLGTANDFAKAAGIPLEPASALAL-LNVAPQPIDLGQA----GDQLFLNMATGGFGSQVTANTSEDLKKVLG 208 Pseudomonas put...
WP_031689670  85 ----LAILPLGTANDFARAAGI-PLEPAAALALLDQTARPIDLGEVN---GK-LFLNMATGGFGSKVTANTSEDLKKVLG 155 Pseudomonas aer...
WP_012437190 117 tlPSLGLVPLGTANDFATAAMIPLEPLGALGLIAERAAEPIDLLRIDadhGPHWCANVASGGFGTQVTVETDAGLKKMLG 196 Xanthomonas cam...
2P1R_A       161 GVSYLIHGLXRXDTLTPDRCEIRGENFHWQGDALVIGIGNGRQAGGGQQLCPTALINDGLLQLRIFTG-EELLPALFSTL 239 Salmonella ente...
WP_002209799 158 GVSYFIHGLMRLDALKADSCKIHGPDFHWSGDALVIGIGNGKQAGGGQLLCPDALINDGLMQLRLLTA-KELLPAVLSTL 236 Yersinia
WP_001273389 161 GVSYLIHGLMRMDTLTPDRCEIRGENFHWQGDALVIGIGNGRQAGGGQQLCPTALINDGLLQLRIFTG-EELLPALFSTL 239 Salmonella ente...
WP_011587774 170 GAAYLLTGLTRFSEIESAKGHFKGEDFEWEGDFLALGLGNGRQAGGGQRLCPDALVNDGLFDVAILPA-DMDLLAGVKEL 248 Alcanivorax bor...
AAN67738     209 AAAYLFTGLSRFSELQAASVELQGPGFHWQGDLLALGIGNGRQAGGGQVLCPEAMVNDGLLDVAILPA-PQEVVGALRDL 287 Pseudomonas put...
WP_031689670 156 GAAYLLTGLTRFSEVHAAQGRFSAPDFQWEGEFLALGIGNGRQAGGGHVLCPQARVDDGLLDVSILPT-PQDMVGTLGTL 234 Pseudomonas aer...
WP_012437190 197 GLAYLITGMSRLGRIDPISAHFTGPDFSWEGEFIALGLGNGRQAGGGQALCPEALIDDGLLDVTIVPAlNGEVAATLGTL 276 Xanthomonas cam...
2P1R_A       240 TQS----DDNP--N--IIDGASAWFDIHAPHEITFNLDGEPLSGQEFHIEVLPGALRCRLPPDCPLL 298 Salmonella enterica subsp. e...
WP_002209799 237 FNG----EKNK--N--VIDATVPWLDITAPNDITFNLDGEPLSGRHFHIEILPHAIQCRLPPNCPLL 295 Yersinia
WP_001273389 240 TQS----DDNP--N--IIDGASAWFDIHAPHEITFNLDGEPLSGQEFHIEVLPGALRCRLPPDCPLL 298 Salmonella enterica
WP_011587774 249 FDSearqDPDQ--EglFVRTRLSEMKIETPTPMNLNLDGEPIQNTTFQIQAIRNALRLYLPEGCPLL 313 Alcanivorax borkumensis
AAN67738     288 LGG----Dg------lFVRARLPWVEIKSSQGLDINLDGEPLQAANLRFQARPAALHLHLPAGSPLL 344 Pseudomonas putida KT2440
WP_031689670 235 LGG----GNGV--EslFVRARVPWLEVEAAEGLDVNLDGEPLEGRKLRFSVSPGALRVHLPAGSPLL 295 Pseudomonas aeruginosa
WP_012437190 277 VTG----GKQAalErvAVRTRLPWLEIASVQPLTLNLDGEPETSRHFRVECVAARLRMHLPIDCPLR 339 Xanthomonas campestris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap