Conserved Protein Domain Family
mena_SCO4490

?
TIGR03701: mena_SCO4490 
menaquinone biosynthesis decarboxylase, SCO4490 family
Members of this protein family are putative decarboxylases involved in a late stage of the alternative pathway for menaquinone, via futalosine, as in Streptomyces coelicolor and Helicobacter pylori. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 163413
View PSSM: TIGR03701
Aligned: 17 rows
Threshold Bit Score: 632.003
Threshold Setting Gi: 499315924
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011372494   3 KTIELLKKNGELRIVDTELDIYLEIPHLAYAEVKkkD-G--GLALLFTNVidk--ksgKKFDEEILMNVFGSYSRCELLF 77  Sulfurimonas de...
WP_011602233  24 AFLAHLERRKDLRRISVPVDPHLEVTEIVTRVVR--E-R--GPALLFESP--------RGADMPLAINLFGTEARMATAL 90  Frankia alni
WP_010986232   8 SLLRALEREGDLKRIKAEVDPYLEVGEIVDRVQK--A-G--GPALLFENV--------RGSAMPLAMNVFGTDRRLLKAL 74  Streptomyces av...
WP_011139367   3 SYLDLLKEHNLLRVIDEPLDIHLEIPHIAYVEVK--KpE--SKALLFTRPidk--ksgKEFETPVVMNLFGSEELVKILV 76  Wolinella succi...
WP_011115339   7 QLITFLQSHNELTIIDEPLDIYLQIPQLAYLEVK--KpT--SKALLFTNPica--ksgKTFDIPVLMNIFGSHQRLNLLV 80  Helicobacter he...
WP_011419434  21 EFLARLDEAGELVRITEPVHPVLEMAALADRAAK--Q-G--GPALLFERP----------GTLPVAMNLFGTRRRASWAL 85  Anaeromyxobacte...
WP_011391643   8 AYLAYLEAHKLLHRVKVEVDPIFEIAAISDRVVK--R-G--GPALLFERV--------KGSTLPVATNLFGSIDLVKAAL 74  Moorella thermo...
WP_001204347   3 DFLKLLKKHDELKIIDTPLEVDLEIAHLAYIEAKkpN-G--GKALLFTQPirkehdqiKTFGMPVLMNAFGSFKRLDLLL 79  Helicobacter py...
WP_002867682   3 EFIQILKENDLLRVIEEPVDVDLEIAHLAYIEAK--K-GekGKALLFKNPidk--klnKQYKFPVLMNTFCNEKALNLAF 77  Campylobacter j...
WP_011227888   7 AYLEALERRGELHRVRVPVSAELEIAEIADRVVK--A-G--GPALLFERV--------VGKDFPVAIGLFGTRARTAFAL 73  Thermus thermop...
WP_011372494  78 G-RTIESVADEITKLLHMKP-PSGFLNKISMASELFSL-KNIFPKKLsR-E--GECQKIKYLENEIDLYKIPVLTTWEQD 151 Sulfurimonas de...
WP_011602233  91 GvDRLDEIGDRLAALLRPEL-PTGLSGLRDALGKAASL-TSIPPRRV-R-T--APCQDVVLKGPDVDLFRLPGVHAWPND 164 Frankia alni
WP_010986232  75 GlKSYGEITDKIGGLLKPEL-PHGFVGVREAFGKLGAM-THVPPRKV-K-D--APVQEVVLRGDDVDLDQLPALFTWPQD 148 Streptomyces av...
WP_011139367  77 G--EVEEIAQSVGEFVQFKP-PKGWAQTLAMLPKLARL-RHVVPKKL-KtK--GLCQQVIKQGEEVDLYELPILTTWEKD 149 Wolinella succi...
WP_011115339  81 D-KPIPQIATHIQHLLRFSP-PKGIKEIFSRLKELAHL-RFVFPKYT-KsK--GLCQDTIIIGEEINLFNLPILTTWEHD 154 Helicobacter he...
WP_011419434  86 ScEDFEEHASELRALLRTAP-PQSFWDKLKMLPKLGKL-AAMAPKHV-S-S--GACQEVVDR--EPDLRTLPVLTTWPHD 157 Anaeromyxobacte...
WP_011391643  75 EvTDLEEPARRLRALLELPAdSGGWLDKLRFLPRLAEL-GRYLPRRV-K-E--APCQEV--RVEPPSLEELPVLQLWPGD 147 Moorella thermo...
WP_001204347  80 K-TPIESLQQRMQAFLHFNA-PKNFTEGLKVLKDLWDL-RHIFPKKT-T-R---PKDLIIKQDKEVNLLDLPVLKTWEKD 151 Helicobacter py...
WP_002867682  78 G-RDYEEVAEEISKLTKLHI-PTSFKAKMDFFMNLLSF-KNIPPKRL-K-KnkALYDYEILN----SLEELPILKTWEDD 148 Campylobacter j...
WP_011227888  74 GvEDLDELARKVEALLALEP-GKGGLSALLGLLPKLPLlRGFFPRRV-R-R--APVQEVVWRGEEVDLRRLPVLKCWPLD 148 Thermus thermop...
WP_011372494 152 GGPFITMAQVYTQSFDGEMVNVGMYRLQVYDKNHLGMHWQIHKDSSHFFDQYQkaG-KKMPVTIAIGGDPLYTWCATAPL 230 Sulfurimonas de...
WP_011602233 165 GGAFLNLGLTHTRHPETGARNLGMYRLQRHDARTVGMHWQIHKDSNAHHAVAErrG-ERLPVAIAFGCDPAVTYAASAPL 243 Frankia alni
WP_010986232 149 GGSFFNLGLTHTKDPESGIRNLGLYRLQRHDKRTIGMHWQIHKDSRNHYQVAArrG-ERLPVAIAFGCPPAVTYASTAPL 227 Streptomyces av...
WP_011139367 150 GGPFITMGQVYTQDLEGRVQNLGMYRLQLYEKNRLGLHWQIHKDSTHFFNQYKaaG-QKMPVSIAIGGDPLYTWCGTAPL 228 Wolinella succi...
WP_011115339 155 GGAFITMGQVYTQSIDGKAKNLGMYRLQVYDEKHLGLHWQIHKDSQHFFHQYKqaG-EKMPVSIALGGDPLYIWCGQAPL 233 Helicobacter he...
WP_011419434 158 GGPFITLPQVITRDPETGIRNVGMYRLQVLGPRRLAMHWQLHKTATAHYRAYQqrG-ERMPVAIALGGDPALTYCASAPL 236 Anaeromyxobacte...
WP_011391643 148 GGRFLTLPLVFTHDPLTGRRNVGMYRMQVFDAVTTGMHWHIHKDGAEHL---RrsG-DRLEVAVALGADPAVIYAATAPL 223 Moorella thermo...
WP_001204347 152 GGAFITMGQVYTQSLDHQKKNLGMYRLQVYDKNHLGLHWQIHKDSQLFFHEYAkaK-VKMPVSIAIGGDLLYTWCATAPL 230 Helicobacter py...
WP_002867682 149 AGKFITMGQVYTQNLDKTQNNLGMYRLQMSDKNELLMHWQIHKDGANFYHEYKnaGfKKMPVSIAIGGDPLYIWCSQAPL 228 Campylobacter j...
WP_011227888 149 GGPFLTLPLVITKDPETGELNLGMYRMQVLDPRSTAMHWQLHKVGRRHLEKAKrlG-RKLEVAVALGGDPVLTYAATAPL 227 Thermus thermop...
WP_011372494 231 PY--GVNELLMYGLIKKESAKLVKSLTNPLYIPHDVDYVIEGWVDTNE-MKIEGPFGDHTGYYTLEESYPVMEVSAITTK 307 Sulfurimonas de...
WP_011602233 244 PA--DIDEYLFAGYLRGERVEMVDCLSVPLRVPANAQIVLEGWLEPGA-RLPEGPFGDHTGFYTPVEPFPALHVDVMTMQ 320 Frankia alni
WP_010986232 228 PG--DIDEYLFAGFIQGKRIEMVDCKTVPLQVPAQAEVVLEGWLEPGE-MLPEGPFGDHTGFYTPQEPFPALKIDCVTMR 304 Streptomyces av...
WP_011139367 229 PY--GVFELLLYGFIRGRRAELVSCLTNPLFVPFDADFVIEGWVDTSK-MRLEGPFGDHTGFYTPIEPYPELEVSAITHK 305 Wolinella succi...
WP_011115339 234 PM--GIFELMLYGFIRSKKPVLCPCITNPLFVPNDVDIVIEGWVDTTQ-MRDEGPFGDHTGFYTPIEPYPVLEVSAITMR 310 Helicobacter he...
WP_011419434 237 PP--NVDEYLFAGFLRGASVHTVTGVATGLDVPADADLVIEGFVDTAApLVREGPFGDHTGFYSLADDYPALDVVAITRR 314 Anaeromyxobacte...
WP_011391643 224 PP--GLDEMLLAGFLRREPVEMVPALTVNIDVPARAEIILEGYVDPGE-TRLEGPFGDHTGYYSPADNYPVFHLTCLTRR 300 Moorella thermo...
WP_001204347 231 PY--GIYELMLYGFMRGKKARVMPCLSNSLSVPSDCDIVIEGFVDCEK-LELEGPFGDHTGYYTPIEPYPVLEVKTISYK 307 Helicobacter py...
WP_002867682 229 PK--GIFELLLYGFIKKTPAKITPCE-NGIFIPYDSDVVIEGYVDLEE-FKIEGPFGDHTGFYTPAELFPVMKVEKIYAK 304 Campylobacter j...
WP_011227888 228 PPlpGVSEFHLAGFLRGAPIELARGVTVDLPVPAEAEFVLEGYIDPEEpLVEEGPFGDHTGFYTPVDLYPRFHVTAVTHR 307 Thermus thermop...
WP_011372494 308 KKPTYLATVVGKPPLEDKYMGWATGKIFFPLLKTTAPDLLDYHMPENGGFHNLILAKMQPHYKGHAKQFMHAFWGAGQMS 387 Sulfurimonas de...
WP_011602233 321 RDPVFQTIVVGRPPQEDGPMGKATERIFRPLIKMMIPEIVDYDLPEAGVFHNCCIVSIDKRFPKHAQKVMNAVWGAGLLS 400 Frankia alni
WP_010986232 305 KRPLLQSIVVGRPPTEDGPLGRATERFFLPLLKIIVPDIVDYHLPEAGGFHNCAIVSIDKKYPKHAQKVMHAVWGAHMMS 384 Streptomyces av...
WP_011139367 306 KNPIYVATVVGKPPLEDKYLGYPTERIFLPLLKTTAPSLIDYYMPENGVFHNLILAKIAPSYPGHAKQIMHAFWGVGQMS 385 Wolinella succi...
WP_011115339 311 KKPIFPATIVGKPPLEDKYMGYLTERVFLPLLQTTAHGLKDYHMPENGVFHNLIFAKIKPDYPSHSKQIMHNFWGVGQMS 390 Helicobacter he...
WP_011419434 315 KDAVYPATVVGPPPVEDQWLGKATERMFLPLMQIVAPEIVDICMPVEGVFHNLCLVSIKKEHPGQAKKVIHGLWGSGQMA 394 Anaeromyxobacte...
WP_011391643 301 RRAVYPATVVGPPPMEDAYLGKVTERLFLPLIQLQLPEVVDINFPPAGVFHNCVIVAIRKAYPGQARKVMHALWGMGQMM 380 Moorella thermo...
WP_001204347 308 KDSIYLATVVGKPPLEDKYMGYLTERLFLPLLQMNAPNLIEYYMPENGVFHNLILAKIHTRYNAHAKQVMHAFWGVGQMS 387 Helicobacter py...
WP_002867682 305 KDAIYQATVVGKPPLEDKIMGLGTERIFLPLLQTSVPDLIDYNMPENGVFHNLILAKIDAKYPAHAQQIMHAFWGVGQMS 384 Campylobacter j...
WP_011227888 308 KGAIYPATLVGVPPMEDAYLIEATERLFLPALRLVLPEVVDYHMPPEGVAHNWVNVSLRKAYPGQAYKVAYGMLGLGQMM 387 Thermus thermop...
WP_011372494 388 FVKHAIFLDEKAPkLDSYDAVTSYILDRFTPKS-LFITEGILDALDHSSDEALIGGK 443 Sulfurimonas denitrificans
WP_011602233 401 LSKLIVVVDADCD-VHDYAEVAWRAFGNVDYAHdLITTIGPVDHLDHASYEQFWGGK 456 Frankia alni
WP_010986232 385 LTKLIVIVDSDCD-VHDLHEVAWRALGNTDYARdLTVVEGPVDHLDHASYQQFWGGK 440 Streptomyces avermitilis
WP_011139367 386 FVKHALFVDEDAPsLREDEALMNHVLARFHPSR-LLLSDGVCDALDHASPEYALGGK 441 Wolinella succinogenes
WP_011115339 391 FVKHAIFVDENAPeLTDYEALGTYILERFSPNN-LLITEGICDALDHASPHFAHGGK 446 Helicobacter hepaticus
WP_011419434 395 QTKTLVVFDEDVD-VQDVSQAAWRAFANVDVKRdLVIADGPVDVLDHAASGFAYGGK 450 Anaeromyxobacter dehalogenans
WP_011391643 381 FTKLIIVVDADVN-VHDLQEVAWRVLGNIDPRRdAVIVDGPVDILDHAAPRRGFGSK 436 Moorella thermoacetica
WP_001204347 388 FVKHAIFVNEDAPnLRDTNAIIEYILENFSKEN-ALISQGVCDALDHASPEYAMGGK 443 Helicobacter pylori
WP_002867682 385 FVKHAIFVDKNAPsLKDYDALIPYMLDRFNTKK-ILISEGICDQLDHASPNSCFGGK 440 Campylobacter jejuni
WP_011227888 388 FAKVIVAVDADVP-VKPGFAALLEALKHALPGRdTLLLRGPVDVLDHSSRAFAFGGK 443 Thermus thermophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap