Conserved Protein Domain Family
NtcA_cyano

?
TIGR03697: NtcA_cyano 
global nitrogen regulator NtcA, cyanobacterial
Members of this protein family, found in the cyanobacteria, are the global nitrogen regulator NtcA. This DNA-binding transcriptional regulator is required for expressing many different ammonia-repressible genes. The consensus NtcA-binding site is G T A N(8)T A C. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 163409
View PSSM: TIGR03697
Aligned: 4 rows
Threshold Bit Score: 319.487
Threshold Setting Gi: 499937558
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011430628  32 GKTIFFPGDPAERVYFLVKGAVKLSRVYEMGEEITVALLRENSIFGVLSFITGQRSDRFYHAVAFTRVELLSLPIEQVEK 111 Synechococcus s...
WP_011057487  51 GKTIFFPGDPAEKVYFLLKGAVKLSRVYEAGEEITVALLRENTVFGVLSLITGTRSDRFYHAVAFTNVELLAVPIEQVEK 130 Thermosynechoco...
WP_011143275  30 GKTIFFPGDPAVRVYFLKRGAVKLSRVYEHGEEITVALLRENSVFGVLSLITGHRSDRFYHAVAFTPVDLIAVGVEQMER 109 Gloeobacter vio...
WP_011618292  52 GKTIFFPGDPAEKVYLIRRGAVRLSRVYESGEEITVALLRENSLFGVLSLLTGHRSDRFYHSIAFTRVEMVTAPATSVRQ 131 Synechococcus s...
WP_011430628 112 SLRENAELSMLLLKSLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPGPNGVTIDLKLSHQAIAEAIGSTRVTI 191 Synechococcus s...
WP_011057487 131 AMHEDPDLPMFMIQGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGIPTSAGVTVDLKLSHQAIAEAIGSTRVTV 210 Thermosynechoco...
WP_011143275 110 IIQEDPDISRLLFQGLASRILQTEMMIETLAHRDMGSRLESFLLILCRDFGLPTKDGVTIDLRLSHQAIAEAIGSTRVTI 189 Gloeobacter vio...
WP_011618292 132 AIEADTSVGLLLLQGLSSRILQTETMIETLTHRDMSSRLVSFLLVLCRDFGVPGQRGITIDLRLSHQAIAEAIGSTRVTI 211 Synechococcus s...
WP_011430628 192 TRLLGELRKKNYISIHKKKITVHDPMQLGHRFA 224 Synechococcus sp. JA-3-3Ab
WP_011057487 211 TRLLGELRDQKMISIHKKKITVHNPLMLSQQFT 243 Thermosynechococcus elongatus
WP_011143275 190 TRLLGDLRKKKLISISKKRITVHDPIKLGQRFA 222 Gloeobacter violaceus
WP_011618292 212 TRLLGDLKSSSLVDIDRKKITVLDPIALAKRFS 244 Synechococcus sp. CC9311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap