Conserved Protein Domain Family
ocin_ThiF_like

?
TIGR03693: ocin_ThiF_like 
putative thiazole-containing bacteriocin maturation protein
Members of this protein family are found in a three-gene operon in Bacillus anthracis and related Bacillus species, where the other two genes are clearly identified with maturation of a putative thiazole-containing bacteriocin precursor. While there is no detectable pairwise sequence similarity between members of this family and the proposed cyclodehydratases such as SagC of Streptococcus pyogenes (see family TIGR03603), both families show similarity through PSI-BLAST to ThiF, a protein involved in biosynthesis of the thiazole moiety for thiamine biosynthesis. This family, therefore, may contribute to cyclodehydratase function in heterocycle-containing bacteriocin biosyntheses. In Bacillus licheniformis ATCC 14580, the bacteriocin precursor gene is adjacent to the gene for this protein. [Cellular processes, Toxin production and resistance]
Statistics
?
PSSM-Id: 163405
View PSSM: TIGR03693
Aligned: 2 rows
Threshold Bit Score: 1181.72
Threshold Setting Gi: 499511060
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000067632   1 MSNLPAHAKLKANKDTFFLPDSNGGVYFRNNASSFRMDGDGIYNWIEKLMPMFNGNYSLAEITDGLPLPYQNRVFEIGEI 80  Bacillus cereus...
WP_011197700   1 MTHLTASARLKVNRDTWFLPDPNGGAYFRNNSGSFRLKGSSIAQWFEKLLPMFNGEHSLEDLTKGLQAPYRKRVYEIGET 80  Bacillus lichen...
WP_000067632  81 LYTNGFVRDVSQDAPHELNSALLDRYASQIEFLEADSHSGALKFETYRNANVLIIGSGDMLTSLVSSLLESGLPTFHYLV 160 Bacillus cereus...
WP_011197700  81 LYKNGFVRDVSRDHPHKLESSVLKTYEAQIEFIESFADSGAYRFQLSRQTKILAAGTGSFLTKLVRSLIDSGFSRIRAIV 160 Bacillus lichen...
WP_000067632 161 TDYEETNYDrihELVELAHEVDDAVlvqEIDTTIDRPLHEVFEPFDWVLYVSQNGDIEGLRAVHAICKEIGKNFIPAVCL 240 Bacillus cereus...
WP_011197700 161 TDASGHALD---ELAEISEQTESGL---EIGFAETQHWREAVRSADWVLYVSDRGFTDDLHDLQTFCLEENKGFIPGICL 234 Bacillus lichen...
WP_000067632 241 STVGLAGPVVTTNREECWESAWHRLHETTLQNENSSAAFSPITSAMLANIIVFELFKHVADDSHREKNPQFFLLNYETLE 320 Bacillus cereus...
WP_011197700 235 KQVGLAGPVFQQHGDSRFEAAWRRLHRSALHEERTLGTFPLAGKDMLANVIVFELMKAAAELEPLSKKNQVYLLDLATLE 314 Bacillus lichen...
WP_000067632 321 GTWHPFIKHPLATDESFTIDTIENLSEKLEHRSNQHTSTDLFRFFDSLTSKETGIFHVWDEQDLHQLPLSQCHIQVATPL 400 Bacillus cereus...
WP_011197700 315 GGWHAFLPHPDFSCGKDSAELICDLEAKLSEHPGKETESRLFQCFTELTSPVTGIFHLWEEKHLPQLPLAQCFVQTADPL 394 Bacillus lichen...
WP_000067632 401 SDGPASLLPLITCSGLTHNEARREAGLVGIETYVAEiMHRLIPEHNDIGIGAGETMTEGVYRALQQHLNNKLYERQSHML 480 Bacillus cereus...
WP_011197700 395 SSGPAELLPETVSVGLTHQEARREAGLTGIEMYASR-LTRSYPNNGDFAIATGETLAEGVLRGLEKCLEHRLCERIKSGK 473 Bacillus lichen...
WP_000067632 481 EEITTVDLTDIHDKNCRFYYDALATIHEAPKIAVSEEILSFPVVWVGINDRWYGASNINTTLALRSALQLSLlhiqNEET 560 Bacillus cereus...
WP_011197700 474 EMISLVQLDGIEDRHSAFYLKALTVLYGQPEIGLGKNIEGFPVAWAGIRGRWYRSSGLNITSALRKVLERAL----TDKD 549 Bacillus lichen...
WP_000067632 561 PYRAnilpesSIILYDTDSFRLEIQAEEEIPstQSVQLALQHLEEHHFYpfVFDLAIESFLKENLDGVYGVLIAKED 637 Bacillus cereus group
WP_011197700 550 PLKG------ADVLLEPGELKLAIPVSAALQ--KTLLSALKNNRGLQLY--VYELPVEPFLKEKLAGIYCVQLRKEE 616 Bacillus lichenifo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap