1Q5Q


Conserved Protein Domain Family
20S_bact_alpha

?
TIGR03691: 20S_bact_alpha 
Click on image for an interactive view with Cn3D
proteasome, alpha subunit, bacterial type
Members of this family are the alpha subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In most Actinobacteria (an exception is Propionibacterium acnes), the proteasome is accompanied by a system of tagging proteins for degradation with Pup. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 163403
View PSSM: TIGR03691
Aligned: 9 rows
Threshold Bit Score: 382.541
Threshold Setting Gi: 501202420
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q5Q_A         1 MTMPY-YASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAENPSTALHKVSELYDRLGFAAVGKYNEFENLRRAGI 79  Rhodococcus ery...
WP_011594076   1 MTMPY-YASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAENPSTALHKVSELYDRLGFAAVGKYNEFENLRRAGI 79  Rhodococcus
WP_011292215   1 MSMPF-YVSPEQIMKDKADYARKGIARGRSAVVLQYEGGILFVADNVSRTLHKISELYDRVAFAAVGRYNEFENLRLAGV 79  Thermobifida fusca
WP_011604020   1 MTMPFgYASPEQQVRDKSEYARKGIARGRSVVVITYADGILFVAENPSATLHKISEIYDRIAFAAVGKYNEFENLRTAGI 80  Frankia alni
WP_003899174   1 MSFPY-FISPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELYDRVGFAAAGKFNEFDNLRRGGI 79  Mycobacterium t...
WP_010988082   1 MSTPF-YVSPQQAMADRAEYARKGIARGRSLVVLQFADGIVFVGENPSRALHKFSEIYDRIGFAAAGKYNEYENLRIGGV 79  Streptomyces av...
WP_011774864  13 MTQQF-YVSPEQLMKDRADFARKGIARGRSVVVISCADGIALIAENPSPSLHKIGEIYDKIAFAAVGKYNEFESLRQAGV 91  Arthrobacter au...
WP_012245438   1 MTQQF-YVSPEQVMKDRADFARKGIARGRSVVVVSSLEGIALVAENPSPSLHKIGEIYDKIAFAAVGKYNEFESLRQAGV 79  Renibacterium s...
WP_011209703   1 MTLPY-YASAEQIMRDKTELARKGIARGRSVVVLTYDKGVLFVAENPSATLHKVSELYDRIGFAAVGKYNEFESLRRGGI 79  Nocardia farcinica
1Q5Q_A        80 VHADMRGYSYDRRDVTGRSLANAYAQTLGTIF-TEQPKPYEVEICVAEVGrvGSPKAPQLYRITYDGSIVDEQHFVVMGG 158 Rhodococcus ery...
WP_011594076  80 VHADMRGYSYDRRDVTGRSLANAYAQTLGTIF-TEQPKPYEVEICVAEVGrvGSPKAPQLYRITYDGSIVDEQHFVVMGG 158 Rhodococcus
WP_011292215  80 RFADMHGYTYDRSDVTGQMLANAYAQTLGAVF-TESSKPWEVEIVVAEVG--DSPDSDQIYRITFDGSVVDERDFLAMGG 156 Thermobifida fusca
WP_011604020  81 RLMDSRGYMYDRRDVTSRALANAYAQTLGAIF-TESVKPYEVEIVVAEVG--PTTDDDQIYKLTFDGSIADERGFVAIGG 157 Frankia alni
WP_003899174  80 QFADTRGYAYDRRDVTGRQLANVYAQTLGTIF-TEQAKPYEVELCVAEVAhyGETKPPELYRITYDGSIADEPHFVVMGG 158 Mycobacterium t...
WP_010988082  80 RYADLRGYTYDRDDVTARGLANVYAQTLGTIFsSAAEKPYEVELVVAEVG--ETPEGDQIYRLPHDGSIVDEHGSVAVGG 157 Streptomyces av...
WP_011774864  92 RYADVRGYSYDREDVTARGLASVYAQSLGAVF-TAEQKPFEVELAVAEVG--VTQEQDHLYRLTFDGSIADENGFVVMGG 168 Arthrobacter au...
WP_012245438  80 RYADVRGYSYDRDDVTARGLASVYAQSLGAVF-TAEQKPFEVELAVAEVG--ENQDQDHLYRLTFDGSIADETGFIAMGG 156 Renibacterium s...
WP_011209703  80 LQADLRGYQYDRRDVTGRALANAYAQALGTVF-NDQLKPFEVEICVAEVGypEQSPEAVLYRINFDGAIVDEREFVVMGG 158 Nocardia farcinica
1Q5Q_A       159 TTEPIATAMRESYRADLDLEAAVGIAVNALRQGg--aG-----EGEKRNVDVASLEVAVLDQ----SRP-R-RAFRRIAG 225 Rhodococcus ery...
WP_011594076 159 TTEPIATAMRESYRADLDLEAAVGIAVNALRQGg--aG-----EGEKRNVDVASLEVAVLDQ----SRP-R-RAFRRITG 225 Rhodococcus
WP_011292215 157 SAERVTAALRERYVKNMSLTDALRVAVHGLAHE----------NGERRELKASSLEVAMLER----SRP-H-RKFRRIQG 220 Thermobifida fusca
WP_011604020 158 ASDQVTTSLKEHHRDGQPLADALRVAVQALTVS----VppglpQNGERVLTAANLEVGMLDR----TRA-R-RQFKRIAG 227 Frankia alni
WP_003899174 159 TTEPIANALKESYAENASLTDALRIAVAALRAGsadtS-----GGDQPTLGVASLEVAVLDA----NRP-R-RAFRRITG 227 Mycobacterium t...
WP_010988082 158 NAEQISTYLDQRHQDGMTLAEALKLAVQSLSRD----T-----NGSEREIPAERLEVAVLDR----TRPqQ-RKFKRIVG 223 Streptomyces av...
WP_011774864 169 LADQISDVVNGAWEPELNLAGAMQLALRALA------T-----NKEVEELPAAAVEAAVLYRdsesNRGsR-RAFRRLLP 236 Arthrobacter au...
WP_012245438 157 QVDSVHQVVAAGWASGSSLADVVGLAVGALGAG----------REPVVELDAANLEIAVLDRdsetSRG-VaRAFRRLNA 225 Renibacterium s...
WP_011209703 159 TTEPIVAALKDSYQPGLDLSSAVGVAVQALQAS----Gpe-gaDKEKRTIGVSQLEVATLEQ----ARP-R-RAFRRVTK 227 Nocardia farcinica
1Q5Q_A       226 TALEQLV 232 Rhodococcus erythropolis
WP_011594076 226 PALEQLI 232 Rhodococcus
WP_011292215 221 ERLARML 227 Thermobifida fusca
WP_011604020 228 PALAELL 234 Frankia alni
WP_003899174 228 SALQALL 234 Mycobacterium tuberculosis
WP_010988082 224 RELSRLL 230 Streptomyces avermitilis
WP_011774864 237 EDMTRLL 243 Arthrobacter aurescens
WP_012245438 226 NEVNDLL 232 Renibacterium salmoninarum
WP_011209703 228 TALEQLL 234 Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap