1Q5R,2JAY


Conserved Protein Domain Family
20S_bact_beta

?
TIGR03690: 20S_bact_beta 
Click on image for an interactive view with Cn3D
proteasome, beta subunit, bacterial type
Members of this family are the beta subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In Streptomyces, maturation during proteasome assembly was shown to remove a 53-amino acid propeptide. Most of the length of the propeptide is not included in this model. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 163402
View PSSM: TIGR03690
Aligned: 11 rows
Threshold Bit Score: 352.858
Threshold Setting Gi: 499292986
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q5R_H        64 HGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEAVYVTDEYSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVPLTFDG 143 Rhodococcus ery...
WP_011774863 100 HATTIVALTYAGGVLMAGDRRATMGNIIASRHIEKVFPADEYSVLGIAGTAGLAIDITRLFQVELEHYEKIEGTLLSLVG 179 Arthrobacter au...
WP_010988081  52 HGTTIVATTFPGGVVLAGDRRATMGNVIAQRDIEKVFPADEYSAVGIAGTAGLAVEMVKLFQLELEHFEKVEGATLSLEG 131 Streptomyces av...
WP_012245439  55 HATTIVAMTFAGGVLMAGDRRATMGTMIASRHIEKVFPADGYSVLGIAGTAGLAIDITKLFQVELEHYEKIEGTPLSLEG 134 Renibacterium s...
WP_011292216  53 EATTIVAVVFSGGVVLAGDRRATSGNVIANRDMDKLFRTDEFSAVGIAGSAGIGIELAKLFQVELEHYEKREGRPLSLEG 132 Thermobifida fusca
WP_011437024  81 HGTTIVAVAFPGGVIMAGDRRATQGHMIAQRDVEKVHHADDYSCVGYAGTAGVGAELIRLFQVELEHYEKIEGSTLSLDA 160 Frankia sp. CcI3
WP_016880752  64 HGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDEYSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVQLTFDG 143 Rhodococcus sp....
WP_011209704  56 HGTTIVAVSYRGGVLIAGDRRATQGNLLASRDMDKVYITDTFSAAGIAGTAGMAVELVRLFAVELEHYEKIEGVPLTFDG 135 Nocardia farcinica
WP_010984244  53 HGTTVLALAYRDGVLIAGDRRATMGNLIAQRDLEKVHPADDYTAVAFAGTVGLALDMVKLYQVELAHFEKVEGVPMTLRA 132 Streptomyces av...
WP_010908271  55 HGTTIVVLKYPGGVVIAGDRRSTQGNMIAGRDVRKVYITDDYTATGIAGIAAVAVEFARLYAVELEHYEKLEGVPLTFAG 134 Mycobacterium l...
2JAY_A        56 HGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAG 135 Mycobacterium t...
1Q5R_H       144 KANRLASMVRGNLGAAMQGLAVVPLLVGYDL----D----AddesRAGRIVSYDVVGG-RYEE-RaGYHAVGSGSLFAKS 213 Rhodococcus ery...
WP_011774863 180 KANRLGAMIRGNLPMAMQGMAVIPLFAGFDQ----V----A----GVGRLFSYDVTGG-RYEE-L-EHHSVGSGSVFARG 244 Arthrobacter au...
WP_010988081 132 KANRLSTMIRSNLAMAMQGLAVVPLFAGYDV----D----R----EKGRIFSYDVTGG-RSEE-H-GYASTGSGSIFARG 196 Streptomyces av...
WP_012245439 135 KANRLGAMVRGNLPMALQGLAVVPLFAGFDP----A----L----SQGRLFSYDVTGG-RYEE-L-EHHSVGSGSVFARG 199 Renibacterium s...
WP_011292216 133 KANRLATMIRSNLGLAMQGFVVVPLLVGYDT----S----R----GEGRIFSYDPVGG-CYEE-H-RYHAIGSGSVYAKG 197 Thermobifida fusca
WP_011437024 161 KANRLAAMVKGNLPMALQGLAVVPLFAGYDL----D----T----GKGRIFSYDIAAA-KSEE-R-TYESIGSGSVFAKG 225 Frankia sp. CcI3
WP_016880752 144 KANRLASMVRGNLGAAMQGLAVVPLLVGYDL----DaddeA----HAGRIVSYDVVGG-RYEE-RaGYHAVGSGSLFAKS 213 Rhodococcus sp....
WP_011209704 136 KANKLSKMVRDNLPAALQGLAVVPVLVGYDEragdP----D----RAGRIVSYDVVGG-RSEErF-GYTAVGSGSMFAKT 205 Nocardia farcinica
WP_010984244 133 KATRLAGMIRQNLGQAMQGLAVVPLLVGYDL----A----Ara-gEHGRIFSFDVTGG-PYEK-T-DFHAEGSGSPYARG 200 Streptomyces av...
WP_010908271 135 KVNRLAIMVRSNLTAAMQGLLALPLLAGYDIhapdP----Q----SAGRIVSFDAAGGwNIEE-E-GYQSVGSGSIFAKS 204 Mycobacterium l...
2JAY_A       136 KINRLAIMVRGNLAAAMQGLLALPLLAGYDIhasdP----Q----SAGRIVSFDAAGGwNIEE-E-GYQAVGSGSLFAKS 205 Mycobacterium t...
1Q5R_H       214 ALKKIYSPDSDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARRIVAERT 287 Rhodococcus erythropolis
WP_011774863 245 ALKKLWKPNLSEEDAISVAVEALYDAADDDSATGGPDPVRQLWPVVYTVNRSGNRRVPERDLAAVAGAIVESRA 318 Arthrobacter aurescens
WP_010988081 197 AMKKLYRDDLTEQQATTLVIQALYDAADDDSATGGPDVARRIYPIVTVITEDGFRRLTDEESSEIARAILERRl 270 Streptomyces avermitilis
WP_012245439 200 AMKKLWKPGLSESDAVQVAVESLFDAADDDSATGGPDVIRKLWPIIYTVTRGGSRKIPQHELGTVVEQVLVRRA 273 Renibacterium salmoni...
WP_011292216 198 ALKKLYRDDLAETDAALVALQALYDAADDDSATGGPDLHRKIYPLVDVITEDGHRRMSHEEVESLAQTVVAARA 271 Thermobifida fusca
WP_011437024 226 SLKKRFRSDLSQDDAVRISVEALYDAADDDSATGGPDVIRKLYPIVAVVTADGYRRYADDEIEPVVTAIIADRS 299 Frankia sp. CcI3
WP_016880752 214 ALKKIYSPDSDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARRIVAERT 287 Rhodococcus sp. DK17
WP_011209704 206 SLKKLYAKGIDQARALRIALESLYDASDDDTATGGPDLLRGIYPTAVVIDAEGALEVPESRLEEIARGIVADRT 279 Nocardia farcinica
WP_010984244 201 ALKKLFHPGMSRREAALAALQALYDAADDDSATGGPDISRRIFPVVSVITEDGFERLPESETEDLSREMVEQRH 274 Streptomyces avermitilis
WP_010908271 205 SIKKLYSQVSDADSALRVAIEALYDAADDDSATGGPDLVRGIYPTAVTIGAEGAAEVTESRIAELAREIIESRS 278 Mycobacterium leprae
2JAY_A       206 SMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRS 279 Mycobacterium tubercu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap