2KYA


Conserved Protein Domain Family
het_cyc_patell

?
TIGR03678: het_cyc_patell 
Click on image for an interactive view with Cn3D
bacteriocin leader peptide, microcyclamide/patellamide family
This model represents a conserved N-terminal region shared by microcyclamide and patellamide bacteriocins precursors. These bacteriocin precursors are associated with heterocyclization. Related precursors are found in family TIGR04446.
Statistics
?
PSSM-Id: 163391
View PSSM: TIGR03678
Aligned: 4 rows
Threshold Bit Score: 58.145
Threshold Setting Gi: 305677563
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KYA_A    1 MNKKNILPQQGQPVIRLTAGQLSSQLAELSEEAL 34  Prochloron didemni
CAO82085  6 MDKKNILPQQGKPVFRTTTGKLPSYLAELSEEAL 39  Microcystis aeruginosa NIES-298
AAY21154  1 MNKKNILPQQGQPVIRLTAGQLSSQLAELSEEAL 34  Prochloron didemni
CAO86916  1 MDKKNLLPNQGAPVIRGISGKLPSHLAELSEEAL 34  Microcystis aeruginosa PCC 7806
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap