Conserved Protein Domain Family
urea_ABC_arch

?
TIGR03669: urea_ABC_arch 
urea ABC transporter, substrate-binding protein, archaeal type
Members of this protein family are identified as the substrate-binding protein of a urea ABC transport system by similarity to a known urea transporter from Corynebacterium glutamicum, operon structure, proximity of its operons to urease (urea-utilization protein) operons, and by Partial Phylogenetic Profiling vs. urea utilization. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 132708
View PSSM: TIGR03669
Aligned: 6 rows
Threshold Bit Score: 679.958
Threshold Setting Gi: 499643711
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004965723  44 LKIGVLEDQSGNFALVGDPKAKASMLAIEEINANGGIDGKQIETFQRDPQSDNQRYQELTRTAINEENVDALWAGYSSAT 123 Haloarcula
WP_014557046  43 IKIGVLEDRSGNFSLVGTPKWRASKLAIDEINADGGIMGKQIELFDPDPQSDNERYQQLTSRLIRQENVDALWAGYSSAT 122 Haloquadratum w...
WP_011504670  31 LKVGLLEDISGDLAFMGMPKLHGSQLAVEEINKSGGILGRQIELIHLDPQGDNARYQEFARRLLNRDKVDVLIGGITSAA 110 Rhodopseudomona...
WP_011473460  31 IKLGVLEDQSGDFAVATIGKVHAIQLAAEEINKSGGIMGRPLELVIYDTQSDNTRYQEFMRRVLQRDKADVVFAGFSSAS 110 Rhodopseudomona...
WP_011322722  36 PTVGILEDRSGNFQLNGTSKWQATRLAIEEINEDGGILGEEVEIVDPDPQSDNERYQELTERLILQDQVDALWAGYSSAT 115 Natronomonas ph...
WP_011324445  42 ITLAVLENRSGKFAELGTSKWQASRLAVEELNESGGALGRKIELIDPDPASDVKRYRQLTTEILEERDVDAIWAGYASSE 121 Natronomonas ph...
WP_004965723 124 REAIRPIIDRNEQLYFYTTQYEGGVCDEFTFAVGPTARQQLGIVLPYLVEEFGPDIYTIAADYNFGQLSADWVKVLANEN 203 Haloarcula
WP_014557046 123 REAIRPTIDRNEQLYFYTTQYEGGVADEYTFCMGPTARQQLGSVVPYMIENFGSDIYTIAADYNFGQLSADWVKVIADEN 202 Haloquadratum w...
WP_011504670 111 REALRPIVGRTSTPYFYTNQYEGGVCDASMISMGAVPEQQFSTLVPWMVEKFGKKVYVVAADYNFGQISAEWNRKIIKDL 190 Rhodopseudomona...
WP_011473460 111 REAYRPIVDQLNGFAFYNNQYEGGVCDGHMIVTGAVPEQQFSTLIPYMMQAYGKKVYTLAADYNFGQISAEWVRKIVKEN 190 Rhodopseudomona...
WP_011322722 116 REAIRPIINDEDQLYFYTTQYEGGVCDDTIFAVGSTARQQLGAVTPYLADQYGEDIYIIAADYNFGQLSGDWVNVIAEEN 195 Natronomonas ph...
WP_011324445 122 REVVRPITNAHRQLYFYTNQYEGGVCDRYTFPVGATARQQLGAVLPYLVSEYGPKIFTIAADYNFGHLSSDWVEILAAEN 201 Natronomonas ph...
WP_004965723 204 DANVLGEEFIPLSESSFGSTINRIQEADPDFVMSMLVGANHTSFYEQKASAGLDVPIGTSTAMAQGYEHRRLDAPAMANI 283 Haloarcula
WP_014557046 203 DAEVIGEEFIPLSVQNFGSTISNIQDADPDFVMAILVGANHSSFWNQRTSAGLEIPMGTSTVMAQGYQHKRLEAPALKDV 282 Haloquadratum w...
WP_011504670 191 GGQVVGEEFIPLGVSQFAQTIQNIQKAKPDWLLTINVGAAQDSFFEQAAAANLNLPMGSSIKVMLGFEHKRFKPPALNNM 270 Rhodopseudomona...
WP_011473460 191 GGEMVGEEFIPLGVSQFSQSIQNIQKAKPDFVVTLLVGTAQASYYEQAASANVNLPMASSVNVGQGYEHKRFKAPSLKDM 270 Rhodopseudomona...
WP_011322722 196 GYNIVGEEYIPLDESDFSSVINRIQAEDPDFIMSMLVGANHENFYDQRDSNDLMIPIGTSTTMAQGHEHIRYEPNAVTDV 275 Natronomonas ph...
WP_011324445 202 DAEVIGTEFVPLSETSFEWLVDRIEAADPDFVMSMLVGDNHAEFFREKATRDLSMPIGTSTAMAQAFEHKRYEPPAFADV 281 Natronomonas ph...
WP_004965723 284 YAGVNYMEEV-PTDSNTgdgGFVDRYFEMYPDAPYLNEEAETNYFSTYMYKKAVEQAGTTEQPEVIDALESG-IELgtee 361 Haloarcula
WP_014557046 283 YGGFNYMEEI-PTSRNE---DYVSRYYDKFPDAGYANEESINNYFSIYMYKQAVEEAGTTDQEAVRDVLESG-MEItg-- 355 Haloquadratum w...
WP_011504670 271 HATANWFEEI-ATPEAE---AFKKRWRAKFPDETYINDMGYNAYNALYMYKTLAEKAKSTKLEDLRKVIATGeACI---- 342 Rhodopseudomona...
WP_011473460 271 YVTTNYIEEI-DSPTAK---AFLAKFKAKFPNEPYVNQEAENSYLAVYLYKQMVERAKSTKRDDIRKVIAQGdVCM---- 342 Rhodopseudomona...
WP_011322722 276 YAGVSYMEELgDLREGE---NFVEDFYDRWPDANYLNQEAQNNYFSVYMWKEAVEEAGTFDQDAVIDVLEEG-VEM---- 347 Natronomonas ph...
WP_011324445 282 YAGVNYMEEL-STQENT---TFVERFYEMFPDADYINQEAQNNYVSIHLYAKAVEAAGTTDQDAVIEQLESG-LSF---- 352 Natronomonas ph...
WP_004965723 362 apeAPEGETIRLDGATHHVDHHMWIMRADDDHNVEAVENRQIP-ETFLSETA----GCNLPENPE--QTQYTP 427 Haloarcula
WP_014557046 356 --dRSPEGDISFQGPVHHMTHNMRVMRCDAEHNITVEDQRKIP-EQFLSETV----GIDLSGEDDgmTKQFTP 421 Haloquadratum walsbyi
WP_011504670 343 ---DAPEGKVCIDPKSQHTSHRMRLISVGPKHDVTVVKDYGTIqPYWLGE-V----GCDLTKKND--KEQYTP 405 Rhodopseudomonas palus...
WP_011473460 343 ---DAPEGKVCIDPKSQHMSHTIYLAKVGADHSITFPKVWEGIkPYWLGDA-----GCDLTKKDP--TAQYTP 405 Rhodopseudomonas palus...
WP_011322722 348 ---NAPSGRIELDGATHHITHQMRVAHADENHDISFDAEQEIg-PSFLREEVeggdGCDLRAESK--TTQYEP 414 Natronomonas pharaonis
WP_011324445 353 ---DAPEGRVAIDGATHHINHTMRIARADEDHNIEFFNEQRID-ETFLSQTV----GCDLREVAE--TTQYRP 415 Natronomonas pharaonis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap