Conserved Protein Domain Family
Rv3369

?
TIGR03667: Rv3369 
PPOX class probable F420-dependent enzyme, Rv3369 family
A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 132706
View PSSM: TIGR03667
Aligned: 6 rows
Threshold Bit Score: 198.46
Threshold Setting Gi: 490009413
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011607681   9 TAFGAKVARRLGEDRIAWLTSTDRSGTPQPAPVWFLWDfaTDSAQLYSEPTARRLSRIQTNPRSSLHLDDDGRGGDFVVL 88  Frankia alni
WP_012642380   2 LTYPPAVLQQLRNESIIWLATVRPDGQPQVVPVWFLWD--DGAVLIYSRPRSQKVRNIRHNPRVSLHFNSDPWAEHVTRF 79  Thermomicrobium...
WP_011563516   2 AVVEPWVERRLREEKILWLTTVRADGQPQPVPVWFLWG--TEGFLIYSRPNAQKLRNIRSNPRVGLNLNCDERGGSVVRA 79  Rubrobacter xyl...
WP_011207281  15 TEFGAKVAERLEREQVVWLTTVGPTGTPQPNPVWFQWR--DGEFLLFSQPDTPKIRNIRRNPRVSVHFNSTVHGGDVVVF 92  Nocardia farcinica
WP_011595966 424 SAITASVADRLARESIVWLTTVGRNDTPVPTPVWFSWS--GTEFLIFSQPGTAKLANIGRNPQVALNFNSSPTGGDVSVF 501 Rhodococcus jostii
WP_003912209   3 VELTQEVSARLTSDLYGWLTTVARSGQPVPRLVWFYFD--GTDLTVYSMPQAAKVAHITAHPQVSLNLDSDGNGAGIIVV 80  Mycobacterium t...
WP_011607681  89 TGVLTTDPQAPPADQNPGYLVKYSEWAKNVFGSVERFATLYSVPLRFRAERT 140 Frankia alni
WP_012642380  80 DGRAELVSDAALANERPAYLAKYRDGISRIGMTPETFAREYSLLIRVYPEHL 131 Thermomicrobium roseum
WP_011563516  80 EGTAEIVEDAAPASEIPEYVQKYREDMRRLGYEPAGFALDYAVAVRVTPRRW 131 Rubrobacter xylanophilus
WP_011207281  93 TGTARIAEDRPTEQEIAAFTAKYTEGLRDIPMTAEQFYADYSVPLRIAPDRL 144 Nocardia farcinica
WP_011595966 502 TGKARVDADGPSPEEWETYVEKYHEDMAGLDYTPEKFRQDYSTLVRVTPDGL 553 Rhodococcus jostii
WP_003912209  81 GGTAAVVATDVDCRDDAPYWAKYREDAAKFGLTEA--IAAYSTRLKITPTRV 130 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap