Conserved Protein Domain Family
IsdH_HarA

?
TIGR03658: IsdH_HarA 
haptoglobin-binding heme uptake protein HarA
HarA is a heme-binding NEAT-domain (NEAr Transporter, pfam05031) protein which has been shown to bind to the haptoglobin-hemoglobin complex in order to extract heme from it. HarA has also been reported to bind hemoglobin directly. HarA (also known as IsdH) contains three NEAT domains as well as a sortase A C-terminal signal for localization to the cell wall. The heme bound at the third of these NEAT domains has been shown to be transferred to the IsdA protein also localized at the cell wall, presumably through an additional specific protein-protein interaction. Haptoglobin is a hemoglobin carrier protein involved in scavenging hemoglobin in the blood following red blood cell lysis and targetting it to the liver.
Statistics
?
PSSM-Id: 132697
View PSSM: TIGR03658
Aligned: 3 rows
Threshold Bit Score: 1572.17
Threshold Setting Gi: 446955549
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001032766   1 MNKHHPKLRSFYSIRKSTLGVASVIVSTLFLITSQHQAQAAENTNTSDKISENQNNNATTTQPPKDTNQTQPATQPANTA 80  Staphylococcus ...
WP_001032759   1 MNKHHPKLRSFYSIRKSILGVASVIVSTLFLITSQHQAQAAENTNTSDKISENQNNNATTTQPPKDTNQTQPATQPANTA 80  Staphylococcus ...
WP_001032805   1 MNKHHPKLRSFYSIRKSTLGVASVIVSTLFLITSQHQAQAAENTNTSDKISENQNNNATTTQQPKDTNQTQPATQPVITA 80  Staphylococcus ...
WP_001032766  81 KNYPAADESLKDAIKDPALENKEHDIGPREQVNFQLLDKNNETQYYHFFSIKDPADVYYTKKKAEVELDINTASTWKKFE 160 Staphylococcus ...
WP_001032759  81 KTYPAADESLKDAIKDPALENKEHDIGPREQVNFQLLDKNNETQYYHFFSIKDPADVYYTKKKAEVELDINTASTWKKFE 160 Staphylococcus ...
WP_001032805  81 KNYPAADESLKDAIKDPALENKEHDIGPREQVNFQLLDKNNETQYYHFFSIKDPADVYYTKKKAEVELDINTASTWKKFE 160 Staphylococcus ...
WP_001032766 161 VYENNQKLPVRLVSYSPVPEDHAYIRFPVSDGTQELKIVSSTQIDDGEETNYDYTKLVFAKPIYNDPSLVKSDTNDAVVT 240 Staphylococcus ...
WP_001032759 161 VYENNQKLPVRLVSYSPVPEDHAYIRFPVSDGTQELKIVSSTQIDDGEETNYDYTKLVFAKPIYNDPSLVKSDTNDAVVT 240 Staphylococcus ...
WP_001032805 161 VYENNQKLPVRLVSYSPVPEDHAYIRFPVSDGTQELKIVSSTQIDDGEETNYDYTKLVFAKPIYNDPSLVKSDTNDAVVT 240 Staphylococcus ...
WP_001032766 241 NDQSSSVASNQTNTNTSNQNISTINNANNQPQATTNMSQPAQPKSSTNADQASSQPAHETNSNGNTNDKTNESSNQSDVN 320 Staphylococcus ...
WP_001032759 241 NDQSSSDASNQTNTNTSNQNTSTINNANNQPQATTNMSQPAQPKSSANADQASSQPAHETNSNGNTNDKTNESSNQSDVN 320 Staphylococcus ...
WP_001032805 241 NDQSSSDASNQTNTNTSNQNTSTTNNANNQPQATTNMSQPAQPKSSANADQASSQPAHETNSNGNTNDKTNESSNQSDVN 320 Staphylococcus ...
WP_001032766 321 QQYPPADESLQDAIKNPAIIDKEHTADNWRPIDFQMKNDKGERQFYHYASTVEPATVIFTKTGPIIELGLKTASTWKKFE 400 Staphylococcus ...
WP_001032759 321 QQYPPADESLQDAIKNPAIIDKEHTADNWRPIDFQMKNDKGERQFYHYASTVEPATVIFTKTGPIIELGLKTASTWKKFE 400 Staphylococcus ...
WP_001032805 321 QQYPPADESLQDAIKNPAIIDKEHTADNWRPIDFQMKNDKGERQFYHYASTVEPATVIFTKTGPVIELGLKTASTWKKFE 400 Staphylococcus ...
WP_001032766 401 VYEGDKKLPVELVSYDSDKDYAYIRFPVSNGTREVKIVSSIEYGENIHEDYDYTLMVFAQPITNNPDDYVDEETYNLQKL 480 Staphylococcus ...
WP_001032759 401 VYEGDKKLPVELVSYDSDKDYAYIRFPVSNGTREVKIVSSIEYGENIHEDYDYTLMVFAQPITNNPDDYVDEETYNLQKL 480 Staphylococcus ...
WP_001032805 401 VYEGDKKLPVELVSYDSDKDYAYIRFPVSNGTRDVKIVSSIEYGENIHEDYDYTLMVFAQPITNNPDDYVDEETYNLQKL 480 Staphylococcus ...
WP_001032766 481 LAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQLTDLQEAHFVVFESEEN 560 Staphylococcus ...
WP_001032759 481 LAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQLTDVQEAHFVVFESEEN 560 Staphylococcus ...
WP_001032805 481 LAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQLTDLQEAHFVVFESEEN 560 Staphylococcus ...
WP_001032766 561 SESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANI 640 Staphylococcus ...
WP_001032759 561 SESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANI 640 Staphylococcus ...
WP_001032805 561 SESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANI 640 Staphylococcus ...
WP_001032766 641 GYEGQYHVRIINQDINTKDDDTSQNNTSEPLNVQTGQEGKVADTDVAENSSTATNPKDASDKADVIEPESDVVKDADNNI 720 Staphylococcus ...
WP_001032759 641 GYEGQYHVRIINQDINTKDDDTSQNNTSEPLNVQTGQEGKVADTDVAENSSTATNPKDASDKADVIEPDSDVVKDADNNI 720 Staphylococcus ...
WP_001032805 641 GYEGQYHVRIINQDINTKDDDTSQNNTSEPLNVQTGQEGKVADTDVAENSSTATNPKDASDKADVIEPESDVVKDADNNI 720 Staphylococcus ...
WP_001032766 721 DKDVQHDVDHLSDMSDNNHFDKYDLKEMDTQIAKDTDRNVDKDADNSVGMSSNVDTDKDSNKNKDKVIQLNHIADKNNHT 800 Staphylococcus ...
WP_001032759 721 DKDVQHDVDHLSDMSDNNHFDKYDLKEMDTQIAKDTDRNVDKGADNSVGMSSNVDTDKDSNKNKDKVIQLNHIADKNNHN 800 Staphylococcus ...
WP_001032805 721 DKDVQHDVDHLSDMSDNNHFDKYDLKEMDTQIAKDTDRNV----DNSVGMSSNVDTDKDSNKNKDKVIQLAHIADKNNHT 796 Staphylococcus ...
WP_001032766 801 GKAAKLDVVKQNYNNTDKVTDKKTTEHLPSDIHKTVDKTVKTKEKAGTPSKENKLSQSKMLPKTGETTSSQSWWGLYALL 880 Staphylococcus ...
WP_001032759 801 GKAAKLDVVKQNYNNTDKVTDKKTTEHLPSDIHKTVDKTVKTKEKAGTPSKENKLSQSKMLPKTGETTSSQSWWGLYALL 880 Staphylococcus ...
WP_001032805 797 GKAAKLDVVKQNYNNTDKVTDKKTTEHLPSDIHKTVDKTVKTKEKAGTPSKENKLSQSKMLPKTGETTSSQSWWGLYALL 876 Staphylococcus ...
WP_001032766 881 GMLALFIPKFRKESK 895 Staphylococcus aureus
WP_001032759 881 GMLALFIPKFRKESK 895 Staphylococcus aureus
WP_001032805 877 GMLALFIPKFRKESK 891 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap