3BMZ


Conserved Protein Domain Family
violacein_E

?
TIGR03650: violacein_E 
Click on image for an interactive view with Cn3D
violacein biosynthesis enzyme VioE
This enzyme catalyzes the third step in violacein biosynthesis from a pair of Trp residues, as in Chromobacterium violaceum, but the first step that distinguishes that pathway from staurosporine (an indolocarbazole antibiotic) biosynthesis. [Cellular processes, Toxin production and resistance]
Statistics
?
PSSM-Id: 132689
View PSSM: TIGR03650
Aligned: 3 rows
Threshold Bit Score: 362.687
Threshold Setting Gi: 164414901
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BMZ_A        6 PPLLPARWSSAYVSYWSPMLPDDQLTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRE 85  Chromobacterium ...
AAZ39195      7 PPLLPMQWSSAYVSYWTPMQADDQVTSGYCWFDYARNICRIDGLFNPWSEKEHGHLLWMSEIGDARREQSRKQKVAYARQ 86  Janthinobacteriu...
ZP_01133841  10 PPLLPAQWSSSYISYWMPMQPDDDITSGYCWFDYTKNVCRIDGIFNPWPEIKMGNRLWMSEIMYPNTDESFKSKVAYARE 89  Pseudoalteromona...
3BMZ_A       86 RTALGEQLCERPLDDETGPFAELFLPRDVLRRLGARHIGRRVVLGREADGWRYQRP-GKGPSTLYLDAASGTPLRMVTGD 164 Chromobacterium ...
AAZ39195     87 AEAAGEQLQGTALADEVTPFHELFLPQAVLLDGGARHDGRHTVLGREADAWVVERA-GKPPSVFYLEAGGNRLLRMVTGN 165 Janthinobacteriu...
ZP_01133841  90 DMKSISEFSAQVLDDEIDPCHELILTQKVLIECNAQYMGIETVLGHQAEKWLFQRPdNKGPATYYFINGTNHLVRMITGD 169 Pseudoalteromona...
3BMZ_A      165 EASRASLRDFPNVSEAEIPDAVFAA 189 Chromobacterium violaceum ATCC 12472
AAZ39195    166 DPQHLSVRDFPNLFVSDIPDSVFTS 190 Janthinobacterium lividum
ZP_01133841 170 PKICASVRDFPNFNTYKIDNEIFKP 194 Pseudoalteromonas tunicata D2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap