Conserved Protein Domain Family
YtoQ_fam

?
TIGR03646: YtoQ_fam 
YtoQ family protein
Members of this family are uncharacterized proteins, including YtoQ from Bacillus subtilis. This family shows some sequence similarity to a family of nucleoside 2-deoxyribosyltransferases (COG3613 as iterated through CDD), but sufficiently remote that PSI-BLAST starting from YtoQ and exploring outwards does not discover the relationship.
Statistics
?
PSSM-Id: 132685
View PSSM: TIGR03646
Aligned: 9 rows
Threshold Bit Score: 228.076
Threshold Setting Gi: 499856496
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011587338   4 WTVYLSGEIHTDWRERIVKGCIDKELDIEFSGPVTDHEASDKVGvSILGAEEKRFWEDRLGAGINGIRTRKLIDEADLVV 83  Alcanivorax bor...
WP_011075283  30 FNVYLSGEIHTDWREEIQRGAEAAGLDVVFTAPVTDHPASDAAG-DHLGETPSDFWRDHQSAKVNAIRTRTLIEKADLVV 108 Corynebacterium...
WP_003184464   3 FIVYLAGEIHSNWREEVKEKAKSLKLPITFVGPMENHERSDNIGeEIMGKQADSIAKDDAASDLNNFRTSVLMNKADVVI 82  Bacillus
WP_010899396   3 LMIYLAGEIHSNWRQQIKEAAKKQDLPFVFLGPMEDHTRSDNIGeEILGKQPDPVLKDDAASSINNLRTTILLNKADVVI 82  Bacillus halodu...
WP_018413523   2 LNVYLAGEIHSNWREEITQLCEKEKLDIKFTFPVTDHEASDNCGvEILGAEEKNFWKDRKGANINSIRTKKSIQDCDVII 81  Candidatus Pela...
WP_011247616   3 LVVYLAGEIHSDWREEIKRLASEKQLPIVFKGPMENHGKSDAIGeDILGKQPNAVLRDEAASSINNFRTRIWLQRADAVI 82  Bacillus clausii
WP_011066630   3 LTVYLAGQIHDNWRDEVEKIAKSKNLPLHFVSPQTTHDRSDDIGeTVIGKQPSNLHRDDAASSINNFRTQVLLSKSDIVI 82  Oceanobacillus ...
WP_011045047   3 LSVYLSGEIHTDWREKIIQGCQESNLNIVFSSAVTHHETSDSAG-DHLGAETEQFWRDNKSAKVNAIRTKTLIERCDVAI 81  Colwellia psych...
WP_011537230   3 LTVYLSGEIHTDWREQIIEGAR--DLDVQFSSPVTDHDASDDCGvAILGAEDSKFWHDHKGAKLNAIRTRKGIEDADIVV 80  Ruegeria sp. TM...
WP_011587338  84 VRFGPKYKQWNAAFDAGYTAALGTPMIILHDEEHDHPLKEVDAAADAVARTPEQVVEMLAYILN 147 Alcanivorax borkumensis
WP_011075283 109 VRFGDKYKQWNAAFDAGYCAALGKPYVTLHDADLIHPLKEVDAEAQGWCQTTDQVVETLRYVLK 172 Corynebacterium efficiens
WP_003184464  83 ALFGEKYKQWNTAMDASYAIAKGKPLIIIRPESLHHPLKELSNKANITVETVNQAIKSLSYVFE 146 Bacillus
WP_010899396  83 ALFGLQYKQWNTTMDAASALALQKPLILIRPKELHHPLKELANKAQVVVETPDQALQALKYIIE 146 Bacillus halodurans
WP_018413523  82 VKFGEKFKQWNAAFDAGYATALNKSMIVIHNDDHQHALKEVDGSAAAVASDQKQAFRILKYILE 145 Candidatus Pelagibacter ubique
WP_011247616  83 ALFGEDYRQWNTAMDAATAIEAGKPLILIRPEKLHHALKELSNKAQVVVETPAQAIAALSYVFE 146 Bacillus clausii
WP_011066630  83 ALFGESYKQWNTAMDASIALTLGKPTIIVRPESLIHPLKEISNKANVTVETVEQALEVIAYIYE 146 Oceanobacillus iheyensis
WP_011045047  82 IRFGDKYKQWNAAFDAGYCAALDKPYITLHSEELIHPLKEVDASAQAWATSVEKVITTLKYISS 145 Colwellia psychrerythraea
WP_011537230  81 VRFGDKYKQWNAAFDAGYAAALGKSIIVLSQPDHQHALKEVHAAALAVADEPRQVVEILTYVLT 144 Ruegeria sp. TM1040
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap