Conserved Protein Domain Family
glyox_marine

?
TIGR03645: glyox_marine 
lactoylglutathione lyase family protein
Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.
Statistics
?
PSSM-Id: 132684
View PSSM: TIGR03645
Aligned: 11 rows
Threshold Bit Score: 315.956
Threshold Setting Gi: 499719675
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011041393   5 YPRTFSHIGISVPSVEKAVKFYTEVLGWYLIMEPTEIEED-DSPIGEMCTDVFGANWGKFKIAHMSTGDRIGVELFEFKN 83  Colwellia psych...
WP_011071263   4 YPRTFSHIGISVPDLDAAVKFYTEVLGWYLIMQPTEIIED-NSAIGEMCTDVFGPNWGSFKIAHLSTGDRIGVELFQFAN 82  Shewanella onei...
WP_011496796   5 YPRSFSHIGISVPDLEAAVKFYTEVLGWYLIMQPTEIVED-ESPIGEMCTDVFGVGWGSFRIAHLSTGDRIGVELFQFTN 83  Shewanella deni...
WP_011469349  28 YPRSFSHIGISVPNLEQAVQFYTEVMGWYLIMQPIDITED-TSAIGEMCTDVFGEGWGSFKIAHLSTGDRIGVELFQFPN 106 Saccharophagus ...
WP_011513361   5 YPRSFSHIGLSVPDLDAAVKFYTEVMGWYIIMEPTEITED-DSAIGEMCTEVFGAGWGSFRIAHLSTGDRIGVEIFEFKN 83  Psychrobacter c...
WP_011575430   5 YPRTFSHIGISVPDVEKAVAFCTQVLGWYLIMKPTVIVED-DSPIGEMCTDVFGANWKKFKIAHLSTGDRIGVEIFEFAN 83  Pseudoalteromon...
WP_011589702   5 YPRNFSHIGLSVTDLDAAVRFYTQVLGWYLIMPPTAITED-NSAIGLMCTDVFGKGWTSLRIAHLSTGDRIGVEIFEFNH 83  Alcanivorax bor...
WP_011329672   5 YPRSFSHIGISVPNVEKAVEFYTQVMGWYTIMEPTEILED-KSPIGEMCTEVFGEKWEKFKIAHLSTGDRIGVEIFEFKN 83  Pseudoalteromon...
WP_011119583   3 YPRTFSHIGLSVTDLDAAVEFYTQTLGWYVIMPPTEIVSD-DSAIGVMCNDVFGEGWGRFRIAHLSTGDKIGVEIFEFKN 81  Rhodopirellula ...
WP_011537579   4 TPRTFSHIGLSVPDLDAAVKFYSEVLGFYVLMPPSKVVED-DSAIGVMCTDVFGPGWEHLRIAHLSTGDGIGIELFEFAG 82  Ruegeria sp. TM...
WP_011400409   5 YPRAFSHIGISVPDIARALDFYQKALGWYVIMDVTEVKEEkDTAIGAMCIDVFGEGWGSFKIAHLSTSDSIGVELFEFPQ 84  Hahella chejuensis
WP_011041393  84 QENPENNFEYWKTGVFHFCVQDPNLEELVEKIVEAGGKKRMAEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYAA 163 Colwellia psych...
WP_011071263  83 QVNPENNFEYWKTGVFHFCVQDPNLEELAEKIVAAGGKKRMKAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELHYAS 162 Shewanella onei...
WP_011496796  84 QENPKDNFEYWKTGIFHFCVQDPNVEELAEKIVAAGGKKRMKAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELHYAS 163 Shewanella deni...
WP_011469349 107 QTNPENNFEYWKTGIFHFCVQDPNVEELAERIVAAGGKKRMAKPRYYYPGKKPYRMIYMEDPFGNILEIYSHSYELIYSE 186 Saccharophagus ...
WP_011513361  84 QEDPDNNFEYWKTGIFHFCVQDPNVEELAERMVAAGGKKRMDKPRYYYPGEKPYRMIYMEDPFGNIVEIYSHSYELIYSE 163 Psychrobacter c...
WP_011575430  84 QQDPADNFEYWKTGVFHFCVQDPNLEELAEAIVAAGGKKRMEKPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYSA 163 Pseudoalteromon...
WP_011589702  84 VEKPENNFEYWKTGVFHFCVQDPDVEGLAEKIVAAGGKQRMPV-REYFPGEKPYRMVYMEDPFGNILEIYSHSYELTYSA 162 Alcanivorax bor...
WP_011329672  84 QENPKDNFEYWKTGIFHFCVQDPDVEGLAERIVAAGGKKRMAEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELIYSA 163 Pseudoalteromon...
WP_011119583  82 AEKPKDNFEYWKTGVFHFCVQDPDVEGLAKRIVANGGKQRMPV-REYFPGEKPYRMVYCEDPFGNIIEIYSHSYELTYSA 160 Rhodopirellula ...
WP_011537579  83 NHAPDDNFAFRRHGTFHFAIQDPDLEGLLEKIIAAGGKQRMPV-REYFPGEKPYRMVYVEDPFGNIFELYSHSYELTYSA 161 Ruegeria sp. TM...
WP_011400409  85 NKTPRHEFNPYQTGVFHFCVQDPDVEGLAQRIVELGGKQRMPI-REYFPGEKPYRMVYMEDPFGNIVEIYSHSYELHYSA 163 Hahella chejuensis
WP_011041393 164 GAY 166 Colwellia psychrerythraea
WP_011071263 163 GAY 165 Shewanella oneidensis
WP_011496796 164 GAY 166 Shewanella denitrificans
WP_011469349 187 GAY 189 Saccharophagus degradans
WP_011513361 164 GAY 166 Psychrobacter cryohalolentis
WP_011575430 164 GAY 166 Pseudoalteromonas atlantica
WP_011589702 163 GAY 165 Alcanivorax borkumensis
WP_011329672 164 GAY 166 Pseudoalteromonas haloplanktis
WP_011119583 161 GAY 163 Rhodopirellula baltica
WP_011537579 162 GAY 164 Ruegeria sp. TM1040
WP_011400409 164 GAY 166 Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap