Conserved Protein Domain Family
cas1_YPEST

?
TIGR03637: cas1_YPEST 
CRISPR-associated endonuclease Cas1, subtype I-F/YPEST
The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the YPEST subtype of CRISPR/Cas system.
Statistics
?
PSSM-Id: 132676
View PSSM: TIGR03637
Aligned: 7 rows
Threshold Bit Score: 507.787
Threshold Setting Gi: 491066860
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011192628  15 ILHSKRSNIYYLEYCRVLVNGGRVEYVTDEGKQ-SLYWNIPIANTTVIMLGTGTSVTQAAMREFARAGVLVGFCGGGGTP 93  Yersinia pseudo...
WP_004928491  12 VMLSKRACVFYLEKVRVVLKDDRIVYLTDNSQPvEYFYNIPEKNTAFLLLGKGSSLTDAAARRLAESNVMVGFCGSGGSP 91  Acinetobacter
WP_002813084   3 ILPSHRQGLYYLEHCRVMAKDERVVYACQEGAF-TKFFAIPPANTNVILLGSGTSLTQAAARLLASEQVMVAFVGGGGSP 81  Nitrosococcus o...
WP_005753659  15 IMHSKRANIYYLEHCRVLLNGGRVEYVTDEGRE-SLYWNIPIANTSCLLLGSGTSITQAAMRELSKAGVMVGFCSGGGTP 93  Pasteurella mul...
WP_011216752  10 ILHSKRANIYYLEKCRIMQKDGRVLYLTEAKNE-NQYWNIPIANTTCLLLGTGTSITQAAMRMLAQAGVLVGFCGGGGTP 88  Legionella pneu...
WP_011240572  12 ILHSKRANIYYLEHCRVLVNGGRVEYITDRGNK-SLYWNIPIANTTTILLGTGTSITQAAMRELGKAGVLVGFCGGGGTP 90  Zymomonas mobilis
WP_000097881  14 ILHSKRANIYYLEKCRVQVNGGRVEYVTSEGKE-SYYWNIPIANTTALILGMGTSVTQAAMREFAHAGVMVGFCGTDGTP 92  Escherichia coli
WP_011192628  94 LFAANDVEvnvsWLTAQSEYRPTEYLHDWVSFWFDDEKRLAAAVAFQRIRIAQIQQHWLSSHIQRESLFPVNHDQLlfil 173 Yersinia pseudo...
WP_004928491  92 LFSSLDLT----FLAPQSEYRPTEYMQIWMKAWLDDDARLLMAKILLLERIVLVSQSWKKNLDLIQHGIYIDENAL---- 163 Acinetobacter
WP_002813084  82 LF-----------LASQNEYRPTEYCQAWMRLWQDNDQRLKVAKTFQRNRAEFLMQQWPKLAEPKPH-----KASLekla 145 Nitrosococcus o...
WP_005753659  94 LFNGTEAEigceFFSPQSEYRPVMYLQQWCKFWFDDEKRLAVAKALQQQRLALLEPIWSKLE------WVYSCEKLtalv 167 Pasteurella mul...
WP_011216752  89 LLMANEVE----WLTPQSEYRPTEYMQGWMKFWFDEQKRLYAAKQFQLSRIEYLRVHWKKSRDLAAEGF--NSDDLqpel 162 Legionella pneu...
WP_011240572  91 LFSANEQEtdvlWFSPQSEYRPTEYVQAWVKFWFDDEKRLRAAKALQLARSSRIKEQWLKPS-LGKDGFLPDERRLsall 169 Zymomonas mobilis
WP_000097881  93 LYSANEVDvdvsWLSPQSEYRPTEYLQQWVSFWFVEDKRLAAAKRFQLIRLTHIDKHWSSSKMLREHAFQPDVNALhtll 172 Escherichia coli
WP_011192628 174 SRFEQNLANCLTSNDLMVQEAVLTKALYKLAANtvNYG-DFTRTKRGGG----IDLANRFLDHGNYLAYGLAATATWVIG 248 Yersinia pseudo...
WP_004928491 164 NTFKQDIDRSENQQELLAAEGRWAKALYKELAK--GFNiDFKRDEGKNShdslTDIANNYLDHGNYIAYGYAAVALNGMG 241 Acinetobacter
WP_002813084 146 ERYLADIELAGDNGTILAQEAKFAKKLYKFWANctETE-NFTRDPGKRDf---NDPFNSYLDHGNYLVYGIAAAVLWVLG 221 Nitrosococcus o...
WP_005753659 168 TQYQHEFAQAAHSQALLAAEGRLTTKLYALANQatMNEpDFKRSERGKS----IDLVNQFLDHGNYLAYGLGATACWVLG 243 Pasteurella mul...
WP_011216752 163 LSSELKIKKAKEVVKLMQNEAELTKQLYRYAANrtQYG-KFIREREA------IDKANIFLNHGNYLAYGLAATTLWVLG 235 Legionella pneu...
WP_011240572 170 HQSEHAIERASDIATLLIEEARLTKALFKLASEtvGYS-DFTRSKRGTG----IDPANRFLDHGNYLAYGLGATATWVLG 244 Zymomonas mobilis
WP_000097881 173 NRTCEEIDAAENHTQLMLVEAKLTKALYKMVSQtvGYG-DFTRAKRGGG----IDMANRFLDQGNYLAYGLAAVAAWVTG 247 Escherichia coli
WP_011192628 249 LPHGLSVLHGKTRRGGLVFDVADLIKDALVLPQAFIAAMQGEEEQEFRQRCISGFQRTEALDVMIDGIKETAA 321 Yersinia pseudotubercu...
WP_004928491 242 ISFALPILHGKTRRGGLVFDLADLVKDAFVMPTAFICASKGLNQKEFRMQLIEICQDQDLLDYMFSFITDICS 314 Acinetobacter
WP_002813084 222 IPHSLPVIHGTTRRGALVFDVADIIKDTCVMPIAFQHAAAGRSDQEMRQACIAWLDESHAMTFLFQSIKRVAQ 294 Nitrosococcus oceani
WP_005753659 244 LPHGLAVLHGKTRRGGLVFDAADIIKDSMILPQAFISAQNGDSEKEFRQACIQNLLRFGALDIIIERLQQLAL 316 Pasteurella multocida
WP_011216752 236 IPHGFAVMHGKTRRGALVFDVADLIKDALILPWAFICAKENSSEQEFRQQCLQAFIDHKALDYMFEQVKAMAL 308 Legionella pneumophila
WP_011240572 245 IPHGLAILHGKTRRGGLVFDVADLVKDATILPQAFLSAMAGDEESSFRQKSIAALTHSESLDFMIDTIKKIAL 317 Zymomonas mobilis
WP_000097881 248 IPHGLAVMHGKTRRGGLVFDLADLIKDALVMPQAFIAAMAGEDAQEFRQRCVNIFQQADALDVMITSLQETAQ 320 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap