3H4P,2KU1,1J2P


Conserved Protein Domain Family
arc_protsome_A

?
TIGR03633: arc_protsome_A 
Click on image for an interactive view with Cn3D
proteasome endopeptidase complex, archaeal, alpha subunit
This protein family describes the archaeal proteasome alpha subunit, homologous to both the beta subunit and to the alpha and beta subunits of eukaryotic proteasome subunits. This family is universal in the first 29 complete archaeal genomes but occasionally is duplicated. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 163366
View PSSM: TIGR03633
Aligned: 22 rows
Threshold Bit Score: 354.264
Threshold Setting Gi: 499466861
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3H4P_A        10 SAYDRAITVFSPEGRLYQVEYAREAVRRGTTAIGIACKDGVVLAVDRRITSKLVKIRSIEKIFQIDDHVAAATSGLVADA 89  Methanocaldococ...
WP_004960819   8 QAYDRGITIFSPDGRLYQVEYAREAVKRGTASIGVRTSDGVVLAVDKRIRSPLMERSSVEKIHKADDHIGIASAGHVADA 87  Haloarcula
WP_009991312   8 MGYDRAITIFSPDGSLYQVDYAFEAVKKGWTAIGIKSKSSVVIASEKRKAQSLLDVDSIEKVFLIDDHVGCSFAGLASDG 87  Sulfolobus solf...
Q975G5         8 MGYDRAITIFSPDGSLYQVDYAFEAVKKGWTTLGVKTKAGVVLIGEKRKATQLLDVDSIEKVFILDDHVGCSFAGLASDG 87  Sulfolobus toko...
WP_011570798   8 QAYDRGITIFSPDGRLYQVEYAREAVKRGTASVGIRTPDGIVLAADKRSRSPLMEPTSVEKIHKTDDHVGIASAGHVADA 87  Haloquadratum w...
WP_010902078   8 QAYDRGITIFSPDGRLYQVEYAREAVKRGTASIGVRTPEGVVLVVDKQTRSPLLEGSSVEKLHKIDDHVGAASAGHVADA 87  Halobacterium s...
WP_011223832   7 QAYDRGITIFSPDGRLYQVEYAREAVKRGTASVGVRTEDGVVIAADRHARSPLIERDSIEKIHEIDSHVGVASAGHVADA 86  Haloarcula mari...
WP_011008503   7 AGYDRAITIFSPEGKIYQVEYAGEAVKRGWPTVGVKCKAGVVLTAEKRKISALFDSSSLEKIYLIDEHVAASPSGLLADA 86  Pyrobaculum aer...
2KU1_A        10 MAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAAVTSGLVADA 89  Thermoplasma ac...
WP_011177605   6 MAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGIKFKDGVALISEKKVRSRLVEKTSLEKIQLIDDRVAAVTSGLVADA 85  Picrophilus tor...
3H4P_A        90 RVLIDRARLEAQIYRLTYGEEISIEMLAKKICDIKQAYTQHGGVRPFGVSLLIAGIDKN-EARLFETDPSGALIEYKATA 168 Methanocaldococ...
WP_004960819  88 RQLIDFARRQAQVNQLRYGEPVGVETLTKEITDYIQQYTQVGGARPFGVALIIGGIVNG-EPRLFETDPSGTPYEWKALA 166 Haloarcula
WP_009991312  88 RVLIDYARNIALQHRLIYDEPVSIDYLTKSVADVKQMYTQHGGVRPFGVALVIAGIDKS-VPKLFMTEPSGQYMPYQAVA 166 Sulfolobus solf...
Q975G5        88 RILIDYARSQALQHRLIYDEPINIDYLTKLVSDVKQMYTQHGGVRPFGVALIIGGIDRGkTPKLLMTEPSGQFMPYYAVA 167 Sulfolobus toko...
WP_011570798  88 RQLIDFARRQAQVNRLRYGEPVGIETLTKNVTDNIQQYTQVGGARPFGVALLIGGIEDG-SPRLYETDPSGTPYEWKAVS 166 Haloquadratum w...
WP_010902078  88 RQLVDFARQQSQVERVRYDEPIGVRTLTKSVTDHIQQYTQVGGARPFGVALLIAGVEGG-EPRLFETDPSGTSNEWKAVA 166 Halobacterium s...
WP_011223832  87 RQLIDVARRQSQVNRLRYDEPASVESLTKEITDYIQQYTQTGGARPFGVALLVAGIEDG-EPRLFETDPSGTPYEWQAVA 165 Haloarcula mari...
WP_011008503  87 RILIDYARDVALSHRFIYDEPIDVEFLTKAVCNLKQQYTQFGGARPFGVALLIAGVDRH-GARLYQTDPSGVYIGYFATA 165 Pyrobaculum aer...
2KU1_A        90 RVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQI-GPRLFDCDPAGTINEYKATA 168 Thermoplasma ac...
WP_011177605  86 RVLIDFARISDQQEKVTYGSLMNIENLVKRVADQMQQYTQYGGVRPYGVSIIFAGLDSI-GPRLFDCDPAGTINEYKCVS 164 Picrophilus tor...
3H4P_A       169 IGSGRPVVMELLEKEYRDDITLDEGLELAITALTKANE--D-IKPENVDVCIITVKDAQFKKIPVEE 232 Methanocaldococcus jannaschii
WP_004960819 167 VGADRGDIRDYLEEHYDEGMDLDEGVDLALAALASVND--DeLSPEGIGVATVDVETETFGQLTDEE 231 Haloarcula
WP_009991312 167 IGQGYYTATEFLEKNYKEDLNVEETILLALKALSATLKpnEkLTPNTVEIGYASTQTGLFLKMTNED 233 Sulfolobus solfataricus
Q975G5       168 IGQGGYTATEYFEKNYREDLNMQDTILLGIRALASTLKpgEkLAPSNIEVGFADVDSGMFRKMSFEE 234 Sulfolobus tokodaii str. 7
WP_011570798 167 IGADRSDLQEHLEENYTEELSLDEGVGLALRTIAISND--DeLTAAGVDVATVASDTEEFIELTNDE 231 Haloquadratum walsbyi
WP_010902078 167 IGSNRGDIQEFLEDEYDAGLSVDDGIDLALRALNEGRE--DaLSGDGVGVGIVDADTGTYRELAADE 231 Halobacterium salinarum
WP_011223832 166 IGGSREDIQTFLEEEYAEGMDLEGGIELALRALASVNE--DgLDATGVDIATIDVESEQFEKLAEDD 230 Haloarcula marismortui
WP_011008503 166 IGAESGTITEFLEKNYKFDMEMGECIELALKALASAVE--I-TDSANVEVAYATIEEKKMRKMSQDE 229 Pyrobaculum aerophilum
2KU1_A       169 IGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLE--EgEELKAPEIASITV-GNKYRIYDQEE 232 Thermoplasma acidophilum
WP_011177605 165 IGAGKDQVTAYLEKEYKENLSEDEAIRMGIAALKSAVA--DeSSMKEPEIASIKM-GETFHVFTSEE 228 Picrophilus torridus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap