Conserved Protein Domain Family
uS9_arch

?
TIGR03627: uS9_arch 
ribosomal protein uS9, archaeal form
This model describes exclusively the archaeal ribosomal protein S9P. Homologous eukaryotic and bacterial ribosomal proteins are excluded from this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 132666
View PSSM: TIGR03627
Aligned: 12 rows
Threshold Bit Score: 184.854
Threshold Setting Gi: 497674693
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011153429   3 HLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAEniipG-ITKEIDINVNVFGGGWHSQTEAV 81  Nanoarchaeum eq...
WP_011500376   5 VVNTSGKNKTAIARATVSVGTGKARINKKPVDIYEPEFAKLKIIEPLMLAK----E-AVSGLDIDVKVSGGGIMGQANAI 79  Methanococcoide...
WP_011323136   2 VTNTSGKKKTAVARATVSDGSGRVRINAEPVELVEPEQARLKMLEPFRIAA----DdLRDEVDIEVTVSGGGFAGQADAV 77  Natronomonas ph...
WP_010875680 153 VIHTSGKRKTAIARGTIREGKGRVRINKVPVELYTPELARLKIMEPLKLAG----D-VINDVDINVRVVGGGIVGQAEAA 227 Methanothermoba...
WP_009988877   7 LVISSARRKTARATCYIYAGKGRVFVNNVPIELIPIEMVRLKIMEPLLLAGn---D-IRSKIDAKIITYGGGIMGQADAA 82  Sulfolobus solf...
WP_011007415  17 VVISVGKKKTAVARAIIKPGIGRVRINGYPLELWPIEMARIKMSEPLILAG----E-LAKKVDIDVNVSGGGYMGQAVAV 91  Pyrobaculum aer...
WP_010869690   4 IVITVGKRKRAIARAVAREGKGRIRINKIPIELIEPKYKRMKLMEPILLAGe---E-VISQMDIDVTVKGGGVMGQMDAA 79  Methanocaldococcus
WP_011449841   3 IINTSGKRKTAVARATFRPGKGVVRINSLLLDVFSTELARMKISEPLQLLP----G-VLEGVDVSIKVAGGGIMGQAEAA 77  Methanospirillu...
WP_011019845   4 VVQTTGKRKTAIARAVIREGEGRVRVNKRPVNIIEPEMARMKIMEPLIIAGe---D-IVSQVDIDVKVQGGGWMSQAEAA 79  Methanopyrus ka...
WP_010878625   6 IVVTSGKRKTATARAVIKPGKGRVRINSVPVEIHQPELARMKIMEPLIIAK----E-LAEKVDIEVKTWGGGFMAQAEAA 80  Archaeoglobus f...
WP_011177125   4 YIIKVGKRKTAIARAIIRKGSGKFLINGYPIELYPIEILREKMLEPIRILG----D-RSKEIDIDVNVHGGGNTGQADAT 78  Picrophilus tor...
WP_010917394   3 YVITTGKRKTAVARAVVKKGKGIITINGTPAELYPVEVLRNKILEPVKLAE----D-KAKGIDVTVKVKGGGVTGQADAS 77  Thermoplasma vo...
WP_011153429  82 RQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQNKSLR--SKPRAWRQTSYR 136 Nanoarchaeum equitans
WP_011500376  80 RTAIARGIVEWTNDTDLRDAFMAYDRNLLVNDSRQTETKKFGG--PGARAKYQKSYR 134 Methanococcoides burtonii
WP_011323136  78 RTAIARGLVEHTNDAELRDAFMSFDRSLLVNDVRQSEPKKWGG--PGARARYQKSYR 132 Natronomonas pharaonis
WP_010875680 228 RMVIARGLVDWTSDMDLKEKFVQYDRTMLVGDPRRSEPKKYGG--RGARARRQKSYR 282 Methanothermobacter thermautotrophicus
WP_009988877  83 RMALARALVKFTGSKELEKIYRAYDRTMLAGDPRQTESEKWMR--YSARRWRQKSYR 137 Sulfolobus solfataricus
WP_011007415  92 RIAMARGLVAFFQSQELKELYERYDPYMLKGDPRRTEHKKPGI--KHARSKRQKAYR 146 Pyrobaculum aerophilum
WP_010869690  80 RTAIGKAIVEFTGSKELRDKFLAYDRTLLVSDARRTEPHKPSRstKGPRAKRQKSYR 136 Methanocaldococcus
WP_011449841  78 RTALARGIVKWHNDPRMKDVYHVYDRSLLVNDSRQKEAKKPHG--RGARKKFQKSYR 132 Methanospirillum hungatei
WP_011019845  80 RIAIARGLVEWTGDPDLRDAYMAYDRHMLKGDPRRKEPKKFGG--RGARARRQKSYR 134 Methanopyrus kandleri
WP_010878625  81 RTAIARALLEFSGDEELRKAFLEYDRTLLVNDVRRKLPKIQGG--RGARARRQTSYR 135 Archaeoglobus fulgidus
WP_011177125  79 RTAMAKAIIEYFKDSDLEAEIRAYDRSMLVNDVRRKMPKKPMG--YGARAKRQKSYR 133 Picrophilus torridus
WP_010917394  78 RTAIARGIVKFLQDNELENLFRQYDRTLIVNDVRIKLPKKPGG--RGARAKKQKSYR 132 Thermoplasma volcanium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap