Conserved Protein Domain Family
urea_t_UrtB_arc

?
TIGR03622: urea_t_UrtB_arc 
urea ABC transporter, permease protein UrtB
Members of this protein family are ABC transporter permease subunits restricted to the Archaea. Several lines of evidence suggest this protein is functionally analogous, as well as homologous, to the UrtB subunit of the Corynebacterium glutamicum urea transporter. All members of the operon show sequence similarity to urea transport subunits, the gene is located near the urease structural subunits in two of three species, and partial phylogenetic profiling identifies this permease subunit as closely matching the profile of urea utilization.
Statistics
?
PSSM-Id: 132661
View PSSM: TIGR03622
Aligned: 3 rows
Threshold Bit Score: 391.919
Threshold Setting Gi: 499641987
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004965724   5 INLALQFLDSFAFIVLAAAGLAIIFGIMGVINLAHGEFILIGAYTATLAVTQLGLPLVVAMLVGGVVTGLFGILTERVII 84  Haloarcula
WP_011572788  20 VSQLLQMADSIAFIALAAIGLTVIFGMMGVINLAHGEFIMMGAYITTLSINVVSLPLPVAMILGALGTAAFGAIVERTII 99  Haloquadratum w...
WP_011322721  10 AALLFQFLDSFAFLVLATVGLAVIFGMMGVINLAHGEFILVGIYGTALTYH-AGLPLPVAMVSGVVMTVIFGIIVERLVV 88  Natronomonas ph...
WP_004965724  85 sgawpnwvsqrtlgrdiiEPLYNRLADSMVATFGLSLILTQGARIRFGNSIDQIATPFGAISygAFSYSTYR-IVLAGVS 163 Haloarcula
WP_011572788 100 ------------------KRLYGRLLDSMIVTFGLGLILTQGTRIIFGNSLRSIGTPFGQVP--GYTYSGYR-VLLLLAA 158 Haloquadratum w...
WP_011322721  89 ------------------QHLYDRLLDSMVATWGLALVVAQLLLITFGSSLDSISTPMGNVAygPYTSGTYRsVFLPLVA 150 Natronomonas ph...
WP_004965724 164 IGLLLATYYLFTRTDFGMRARATIQDKETAQAMGVNTDRMYMLTFGIGSALAGLTGALFAP-VISMQPTLGDQFLVEAFV 242 Haloarcula
WP_011572788 159 IGVLGSVYLAFTRTEFGVRARATIQDPETARAMGVDTDRMYTITFAIGSGLAGLTGALYAP-SATIVPGMGQSFLVESFV 237 Haloquadratum w...
WP_011322721 151 LAVLVGLYVLFTRTEFGVKARATIEDPETARAMGIDTDRMYVTTFALGSGLAGLTGALYAPaIGAITPDRGSIFLVEAFV 230 Natronomonas ph...
WP_004965724 243 AVVVGGPSVVLGTALSGGVLGAILATFSNLYGTFIGRIALLVAALIALRFLPDGITGFIEQLR 305 Haloarcula
WP_011572788 238 TVVTGGSSVLLGTALAGGILGTINAVFSNLYGNFFGQIALLMTAIIIIRLLPGGLTGLANTVR 300 Haloquadratum walsbyi
WP_011322721 231 AVVVGGPSVVIGTLSASGLLGFVNAVFSFQLGTFVGLMAMLIVAIIALRVLPDGISGYIEQWR 293 Natronomonas pharaonis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap