Conserved Protein Domain Family
F420_MSMEG_2256

?
TIGR03617: F420_MSMEG_2256 
probable F420-dependent oxidoreductase, MSMEG_2256 family
Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes one such subfamily, exemplified by MSMEG_2256 from Mycobacterium smegmatis. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 132656
View PSSM: TIGR03617
Aligned: 10 rows
Threshold Bit Score: 477.264
Threshold Setting Gi: 500045489
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011563926  21 ARAAEELGFSGLVTSETKHDAFLPLAVAGSVTRRLQLLTSVAIAFSRSPMEMAQTAWDLQELSEGRLILGLGTQVRAHIT 100 Rubrobacter xyl...
WP_011728259  26 ARDLETAGCDGCWTGEINHDPFLPLALAAEHTRRIQIGTSIAVAFARNPMTVAHLGWDLQAYSGGRFILGLGTQIRPHIE 105 Mycobacterium s...
AFE16293      22 avaLERNGFDGGWTAEASHDPFLPLLLAAEHTSRLELGTNIAVAFARNPMIVANVGWDLQTYSKGRLILGLGTQIRPHIE 101 Mycobacterium t...
WP_011604296  20 SRELESLGYDALYVPETAHDPFLPVVLAAQATERVMIRTGVAVAFPRSPMHLAMVANDLHTISRGRFVLGLGSQVKPHIE 99  Frankia alni
WP_011603991  18 ARTLEDAGYGGLWIGETQHDPFLSSLQAINATRTATVGTSIAIAFARTPMTLANIGFDLAQASEGRFVLGLGSQVKAHIE 97  Frankia alni
WP_029104292  26 AARAQDIGFDGIWSTDVDRDPFLPLAVAAMTTTNVQLGTGIAVAFARNPMTTAMAANDLQEMSDGRFVLGLGTQIQAHIE 105 Mycobacterium s...
WP_012256339  26 akaaeaLGFAALWAPETAHNPFLALTIAAEHTQQLTIGTAVAIAFPRSPMVTAQIAWDLAGFSGGRFVLGLGTQVKAHIE 105 Chloroflexus
WP_011605101  17 ARAAQEAGYDGVWASEVNQDPFLPLTLAADATSTIELGTSIAVALSRSPMSLAYTAHDLARFSGGRFVLGLGSQVKAHIT 96  Frankia alni
WP_014877279  24 THALVEAGATGVFTFEGPHDVFAPLTLASTVGG-VDLMTNVAIAFPRNPIHLAHQAIDHQLLSGGRFTLGLGTQIRTQIE 102 Mycobacterium s...
WP_011726207  18 aaeiaaTGADGLFTFEGQHDVFFPLLIAAEATG-CELMTNVAIAPPRSPMHLAYAAYDLQLYSGGRFRLGLGSQIKVHVE 96  Mycobacterium a...
WP_011563926 101 RRFGMPWGRPVARFREYILALRAIWDAFQNGTPLNFEGEFYRHTLLTPFFNPGPIDHPEIPVYIAGVGERLARLAGELCD 180 Rubrobacter xyl...
WP_011728259 106 KRFSMPWSHPVRRMREYIAALQAIWTCWRDGTSLRFEGEFYTHKIMTPMFTPEPSPAPFPKVFVAAVGERMTEMCGEAAD 185 Mycobacterium s...
AFE16293     102 KRFSMPWGHPARRMREFVAALRAIWLAWQDGTKLCFEGEFYTHKIMTPMFTPEPQPYPVPRVFIAAVGEAMTEMCGEVAD 181 Mycobacterium t...
WP_011604296 100 KRFSAVWSEPAKRMREIVLAIQAIWRCWNDGERLDFQGEFYQHTLMTPFFNPGPNPYGTPRIQLAALGPRMTEVAGEVSD 179 Frankia alni
WP_011603991  98 RRFSMPWSRPAARMRELVLAMRAIWACWQDGTRLDFRGDFYTHTLMTPFFSPPAHAYGPPPVYLAGVNELMTEVAGEVAD 177 Frankia alni
WP_029104292 106 RRFSMPWSAPAERMSEYVNAIRAIWRSWRTGERLDFRGDHYQHTLMTPMFTPTPHPHGDPKIVISAVGPRMTRVAARDAD 185 Mycobacterium s...
WP_012256339 106 RRFSSVWDSPVGRLRDYIGALRAIWHCWQTGGKLDYRGQYYQHTLMTPFFSPGPIAHPDIPIYIAGVNTGLAHLAGEVCD 185 Chloroflexus
WP_011605101  97 RRFSMPWGRPGPQMREFILAMRAAWSSWADGTPLSFEGEYYRHTLMPPTFVPAPHPYGPPRVLLAGVGDVMTRVAGEVAD 176 Frankia alni
WP_014877279 103 KRFGADFERPVGRMRELIGALRAIFDAWQTGERLDFRGEFYRHTLMTPTFSPGPSPYGPPPIYVGALGPQLTRATAELAD 182 Mycobacterium s...
WP_011726207  97 KRYGSKWEPPAARMAEAISAIKAIFAAWEGRARLDFRGEFYTHTIMAPTFDPGPNPYGPPPVLLGALGPMMTRTAAEVAD 176 Mycobacterium a...
WP_011563926 181 GFHVHPFHSPEYVRRVVRPGIAAGAAEAGR-------SPEEVRLATSVFVITGESREELEAQREAMRAQAAFYASTPTYR 253 Rubrobacter xyl...
WP_011728259 186 GLLAHAFTTRRYLDEVTLPALQRGMDRTGR-------SRNDFEVSCPVFLVTGSDEHQMAEAAVATRKQLAFYGSTPAYR 258 Mycobacterium s...
AFE16293     182 GHLGHPMVSKRYLTEVSVPALLRGLARSGR-------DRSAFEVSCEVMVATGADDAELAAACTATRKQIAFYGSTPAYR 254 Mycobacterium t...
WP_011604296 180 GILLHGLSSERFVREVTLPALERGLARAGR-------KRSDVELTFPTLIATGDTDEELAESEKKLRQHFAFYASTPAYS 252 Frankia alni
WP_011603991 178 GFFLHPFTTSRYIEEVTLPALRRGRAKAGRvgpdgegTLDGFTLAGPTFVTVGRDEVELAAAAAGTRGQIAFYASTPAYR 257 Frankia alni
WP_029104292 186 GLLVHGFTTQRYLSEVTLPIVEEELRKVGR-------RRADFTISYPGLIASGSTDEELTRAVSAVRRQIAFYGSTPAYR 258 Mycobacterium s...
WP_012256339 186 GFHAHPLTSARYLREVLRPQIAAGATAAGR-------DPSACAIAGSALVITGNDKTERERMRAMVRQQIAFYASTPTYR 258 Chloroflexus
WP_011605101 177 GFLCHGFTTARWIREHTLPALAEGRRRAGG-------DLTGFDVVAGAFLATG-TEQEIVEGLATIRGQISFYGSTPAYR 248 Frankia alni
WP_014877279 183 GLLVMPFGSKRFLHEVTVPAVRAGLNAAGR-------SADDFAVVPEIIVSVGEDDRD----HDATRRLLAFYGSTPAYR 251 Mycobacterium s...
WP_011726207 177 GLLVMPFNSARHFAERTLPAIGEGLRRSGR-------TLTEFPIIAQAMVAVGRDEADLATAIDGVASLIAFYGSTPAYL 249 Mycobacterium a...
WP_011563926 254 TVLEVHGWQGVGERLSELARRKRWEEMPGLISDEMLSAFAVEAPPEELGEALRERYGGLMERISLYVQ-FVPGerERFWR 332 Rubrobacter xyl...
WP_011728259 259 KVLELHGWGDLHTELHRLSLAGEWDTMGTLIDDDVLDAFAVVAPLDELADALRRRCEGAIDRVLPGFP-AAVP--PATVN 335 Mycobacterium s...
AFE16293     255 KVLEQHGWGDLHPELHRLSKLGEWEAMGGLIDDEMLGAFAVVGPVDTIAGALRNRCEGVVDRVLPIF--MAAS--QECIN 330 Mycobacterium t...
WP_011604296 253 AVLELHGWGGLQRDLYELTRDGRWQDLGSLVTEEVLEVFTARGTPEDIPKQIRARVGDIADRVSFYSP-APIT--PEVIS 329 Frankia alni
WP_011603991 258 GVLDLHGWGDLQPELTRLTRQGRWAELGDLIDDDMLRAFSVVGTPEEVGEQLRAKLTGVYDRATFYTA-YKVA--SEIWP 334 Frankia alni
WP_029104292 259 HVLELHGWHDLHTELHRLSKAGDWTTMTGLIDDEVLNTFAAVGEPTEAGAEVVTRFAGLVDRFTLLTP-YPLG--DEaaa 335 Mycobacterium s...
WP_012256339 259 AVLSCHGWDAVGEELSRLAAQQRWAEMTGLIDDTMVATFAVEADPADLPAALKERYEGLLDRVALYIP-FIPGerDDFWR 337 Chloroflexus
WP_011605101 249 PVLDLHGWGELGAELTVLSKQNRWAEMATLIDDDVVEAFAVVAPPAEVPARIAERFAGLATRLSFTPP-PSLG--ADEVR 325 Frankia alni
WP_014877279 252 PVLEAHGWGDLQPELNAMSKQGRWQEMSALIDDDVLHTIAACGSPAEIAAHIADRVAGVGDRVCLYQP-TPIS--LDSLA 328 Mycobacterium s...
WP_011726207 250 PVLQVEGWDGIQPELNALSKQGRFAQMRGLITDELVARIGIVGTPEQCAEQIAARFGEHADEVCCYFPgYTPR--PADVA 327 Mycobacterium a...
WP_011563926 333 RLVEALLG 340 Rubrobacter xylanophilus
WP_011728259 336 AVLDEFRD 343 Mycobacterium smegmatis
AFE16293     331 AALQDFRR 338 Mycobacterium tuberculosis RGTB327
WP_011604296 330 RILAGLKG 337 Frankia alni
WP_011603991 335 ALLDASRP 342 Frankia alni
WP_029104292 336 aivagara 343 Mycobacterium smegmatis
WP_012256339 338 HLTTSLNG 345 Chloroflexus
WP_011605101 326 ELVGALRA 333 Frankia alni
WP_014877279 329 QIVDGLRT 336 Mycobacterium smegmatis
WP_011726207 328 DLIGALHR 335 Mycobacterium avium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap