Conserved Protein Domain Family
RutG

?
TIGR03616: RutG 
pyrimidine utilization transport protein G
This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the uracil-xanthine permease family defined by TIGR00801. As well as the The Nucleobase:Cation Symporter-2 (NCS2) Family (TC 2.A.40).
Statistics
?
PSSM-Id: 132655
View PSSM: TIGR03616
Aligned: 3 rows
Threshold Bit Score: 661.161
Threshold Setting Gi: 491069310
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P75892         1 MAMFGFPHWQLKSTSTESGVVAPDERLPFAQTAVMGVQHAVAMFGATVLMPILMGLDPNLSILMSGIGTLLFFFITGGRV 80  Escherichia col...
WP_012006243   1 MANTWFPQWRMKQGSLDGSIVAPDERLSLAQTLVMGLQHAVAMFGATVLMPLLMGFDANLAILMSGIGTLLFFLVVGGRV 80  Serratia protea...
WP_004930938   3 SQEPWFAKFKPYQGDLEHHPVQIDEYLPAGKSIVLGLQHAFAMFGATVLAPLLMGFDPNLTIFITGFGTILFFLITGGRL 82  Acinetobacter
P75892        81 PSYLGSSAAFVGVVIAATGFNGQGINPNISIALGGIIACGLVYTVIGLVVMKIGTRWIERLMPPVVTGAVVMAIGLNLAP 160 Escherichia col...
WP_012006243  81 PSYLGSSAAFVGLVITLTGYGGQGANPNIALALGGIIACGLVYLLIGLVVMSVGTRWIERLMPPVVTGAVVMAIGLNLAP 160 Serratia protea...
WP_004930938  83 PSYLGSSFAFIAAVAAATGYNGVGTNPNLALALGGTVVCGVIYAAIGLIVMRTGTAWIEKLMPPIVTGAIVMIIGLNLAP 162 Acinetobacter
P75892       161 IAVKSVSASAFDSWMAVMTVLCIGLVAVFTRGMIQRLLILVGLIVACLLYGVMTNVLGLGKAVDFTLVSHAAWFGLPHFS 240 Escherichia col...
WP_012006243 161 IAVRSVSASNFDSWMAVTTILCIGSVAVFTRGLMQRLLILVGLIAAYLIYVIATNGFGLGKPVDYSALSQAAWFGLPQFT 240 Serratia protea...
WP_004930938 163 VTIKGVSGNGFDTWMAVLTILCISAVAVFTRGMLRRLLLLVGLCAAYFAYFILANVFGLGKAIDFSPIAQAAWLGIPNFH 242 Acinetobacter
P75892       241 TPAFNGQAMMLIAPVAVILVAENLGHLKAVAGMTGRNMDPYMGRAFVGDGLATMLSGSVGGSGVTTYAENIGVMAVTKVY 320 Escherichia col...
WP_012006243 241 TPVFNLHAMLLIAPVAIILVAENLGHVKAVAGMTGRDLDPYIGRAFVGDGLATMLSGSVGGTGVTTYAENIGVMSVTKIY 320 Serratia protea...
WP_004930938 243 TPVFQANAILLIAPVALILVAENLGHFKAVSAMTGRNLSPYMGRGFFADGVCTTLSASVGGTGMTTYAENIGVMAVTKVY 322 Acinetobacter
P75892       321 STLVFVAAAVIAMLLGFSPKFGALIHTIPAAVIGGASIVVFGLIAVAGARIWVQNRVDLSQNGNLIMVAVTLVLGAGDFA 400 Escherichia col...
WP_012006243 321 STLVFVAAALVAIVLGFSPKFGALIHTIPGPVLGGASVVVFGLIAVAGARIWVQNKVDLGDNGNLIMVAVTLVLGAGDFA 400 Serratia protea...
WP_004930938 323 STTVFVVAGVFAILLGLSPKFGAVIHTIPVALLGGASIVVFGLITVAGAKIWIDHKVDFTQNSTLIIAAVSLIMGAGNFS 402 Acinetobacter
P75892       401 LTLGGFTLGGIGTATFGAILLNALLSRKL 429 Escherichia coli K-12
WP_012006243 401 LTIGNFTMGGIGTATFGAIILNALLRRRK 429 Serratia proteamaculans
WP_004930938 403 LHIGAFDLGGIGTATLAAIVLNLLLNRDS 431 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap