Conserved Protein Domain Family
RutF

?
TIGR03615: RutF 
pyrimidine utilization flavin reductase protein F
This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.
Statistics
?
PSSM-Id: 132654
View PSSM: TIGR03615
Aligned: 6 rows
Threshold Bit Score: 263.582
Threshold Setting Gi: 17936376
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_533166     19 QRSLDYRNAMARLGAAVNIVTTDGAAGRAGFAATAVCSVSDNPPTLLVCLNRNASAYKVVKANGVICINTLAAHHEVLST 98  Agrobacterium t...
EDO25005      11 VDAAAFREAMSRLASAVHLITTDGPGGRAGFTASAVCSVSDAPPTLLVCINRASSAYAALTQNGTLCVNTLGEGHETVAS 90  Methylobacteriu...
ZP_01700246    4 VDQQTFRDAMSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSAGQEPLSN 83  Escherichia col...
WP_011914624  16 VIREDYRDAMARLAAAVNIITTDGPSGRAGFTATAVCSVTDEPPTLLVCLNRSASAHPIVTANGQLCVNTLAGAQRDLSN 95  Pseudomonas stu...
WP_024640136  16 VSQLAFRDAMSGLAAAVNLITTDGPGGRAGFTATAVCSVTDQPPTLLVCINRSASVYDAFIENGTLCVNTLGNGQQDLSN 95  Pseudomonas syr...
WP_004930941  29 VDQQAFRQGMSNLGAAVNVITTDGVAGKSGFTASAVCSVTDTPPTLLVCLNRSASVFETFKQNQVLCVNTLAAHQAHLSN 108 Acinetobacter
NP_533166     99 LFGGKTPAEERFAAGSWGVLETGAPVLEDALVSFDCRIREAHDGGTHDILICTVVDMKINAGDEALMYFNRRYRVL 174 Agrobacterium tumef...
EDO25005      91 LFGGRTPVDERFAAGTWRRLRSGAPALADALVSFDCRIVGRHAVGSHDVLYCAVEAVAASGQADALLYSERRYRTL 166 Methylobacterium ch...
ZP_01700246   84 LFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHATPYGLVWFDRSYHAL 159 Escherichia coli C ...
WP_011914624  96 LFGGKTPMAERFAAAQWSTGVTGSPLLDGATVSFDCRISHSASVGTHDILYCEVLAVYRRDSSDALVYFGRNYHGL 171 Pseudomonas stutzeri
WP_024640136  96 LFGGKSSQQERFAGGQWEAGVTGAPVLDSAKLALDCKVSQSVSVGTHDILFCEVVDIRHQSGADALVYFGRRYHHL 171 Pseudomonas syringae
WP_004930941 109 IFGGKTPMVDRFAHGEWRTLATQAPVLTDALVSFDCEVVQSLSVGSHDVFFCQVKAIQHCQGQNALMYFNRNYCEP 184 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap