Conserved Protein Domain Family
RutB

?
TIGR03614: RutB 
pyrimidine utilization protein B
Statistics
?
PSSM-Id: 163356
View PSSM: TIGR03614
Aligned: 5 rows
Threshold Bit Score: 436.955
Threshold Setting Gi: 502289512
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_032191665   3 TLTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAG 82  Escherichia coli
P58760         2 TLPARPEPITLKPSETAVVVVDMQNAYSTEGGYVDLAGFDISGAKGTIANIKKTLDAARAAGVQVIYFQNGWDKDYVEAG 81  Agrobacterium f...
WP_012640590  14 MLPARPEPLPVDPKTTAVIVIDMQNAYASPGGYLDLAGFDISGAAKVTHEIKGVLEVARSAGMTVIYFQNGWDDGYVEAG 93  Caulobacter vib...
WP_004930948  17 VLKAEPEAIQLAPEQTALIVVDMQNAYTSIGGYLDLAGFDVSKTKPVVENIQKAVTAAHAAGIQVIYFKNGWDNQYVEAG 96  Acinetobacter
WP_012752595  20 TLPARPEPVAFDADATVLIVVDMQNAYATKGGYLDLAGFDVSATGPVIERIARAVAAARAAGIRVVWFQNGWDPDYVEAG 99  Methylobacteriu...
WP_032191665  83 GPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIA 162 Escherichia coli
P58760        82 GPGSPNWHKSNALKTMRKRPELQGQLLAKGTWDYAIVDELQPQPGDILVPKTRYSGFFNTNMDSVLRARGIRNLVFVGIA 161 Agrobacterium f...
WP_012640590  94 GPGSPNWWKSNALKTMRARPELQGKLLARGQWDYELVDDLTPQPGDIRLHKTRYSGFFNSQLDSVLRARGIRHLVFTGIA 173 Caulobacter vib...
WP_004930948  97 GAGSPNFHKSNALKTMRKQPELQGKLLAKGGWDFELIDELQPKSQDIVIEKPRYSGFFNTALDSMLRARGIRNLVFVGIA 176 Acinetobacter
WP_012752595 100 GPGSPNWHKSNALKTMRLRPQMNQRLLAKGTWDYALVDALTPEPGDIVLPKPRYSGFYNTPLDSMLRARGIRTLVFTGIA 179 Methylobacteriu...
WP_032191665 163 TNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDVETFCDALSPTSFAH 228 Escherichia coli
P58760       162 TNVCVESSLRDAFHLEYFGVMLEDATHHLGPDFIQQATVYNVEKFFGWVATVNDFCGVISQAAPVT 227 Agrobacterium fabrum str. C58
WP_012640590 174 TNVCVESTLRDGFMLEYFGTVLEDATHQAGPDFVQKAALFNIETFFGWVSTTADFKGTFGQLAPG- 238 Caulobacter vibrioides
WP_004930948 177 TNVCVESTLRDGFFLEYFGVALDDACYQAGPVEMHRASMYNIKTFFGWVSDTQSFVNTFQHNQQLA 242 Acinetobacter
WP_012752595 180 TNVCVESTLRDGYHREYFGIVLADATHQAGPPALQEGALRNIETFFGWVSDVAAFEAALSSDEARR 245 Methylobacterium extorquens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap