Conserved Protein Domain Family
RutA

?
TIGR03612: RutA 
pyrimidine utilization protein A
This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the luciferase family defined by pfam00296 and is likely a FMN-dependent monoxygenase. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 163355
View PSSM: TIGR03612
Aligned: 7 rows
Threshold Bit Score: 659.215
Threshold Setting Gi: 490054656
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003956965   1 MDIGVFLPIGNNGWLISKSSPQYMPSFELNKAIVQRAEEHGLDFALTMIKLKGFGGETEFWDHCLESFTLTAGLAAVTER 80  Streptomyces cl...
WP_001619307   1 MKIGVFVPIGNNGWLISTHAPQYMPTFELNKAIVQKAEHYHFDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSR 80  Escherichia coli
WP_024640134   1 MDIGIFIPIGNNGWLISSNAPQYMPTFELNKQIVQKAEGYGFDFALSMIKLRGFGGKTQFWEHNLESFTLMAGLAAVTSR 80  Pseudomonas syr...
WP_010920639   1 MQVGVFIPIGNNGWLISETSPQYMPSFELNKEITQKAEKYGFDFALSMIKLRGFGGKTEFWEHNLESFTLMAGLAAVTSK 80  Caulobacter vib...
WP_006312122   1 MEVGVFIPIGNNGWLLSENAPQYKPSFDLNKAITLKAEQYGFDFALSMIKLRGFGGKTEFWDYNLESFTLMAGLAAVTSK 80  Agrobacterium
WP_004930951   1 MKIGVFCPIGNNGWLLSENAPQYMPSFELNKKIVQRAEHYGFDFALSMIKLRGFGGKTEFWDHNLETFTLMAGLAAVTSK 80  Acinetobacter
WP_012752596   1 MNIGVFIPIGNNGWLLSENAPQYMPSFELNKQITLKAEQHGLDFVLSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSR 80  Methylobacteriu...
WP_003956965  81 IKLYASAPVLALPPAIAARMAVTIDSIAPGRAGVNIVTGWAPPEYAQMGLWPGDEHFANRYTRAAEYVTVLRQLWSEGVS 160 Streptomyces cl...
WP_001619307  81 IQIYATAATLTLPPAIVARMAATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQVLRDLWGTGKS 160 Escherichia coli
WP_024640134  81 IQLFATVATLTIPPAIAARMASTIDSISNGRFGINLVTGWQKPEYEQMGLWPGDEFFHTRYEYLAEYAQVLRDLWATGSS 160 Pseudomonas syr...
WP_010920639  81 IKIFATVATLTIPPAIVARMASTIDSIAPGRFGVNLVTGWQKAEYSQMGLWPGEAHYTDRYNYLAEYTTVLKDLLETGVS 160 Caulobacter vib...
WP_006312122  81 IKLFGTAATLVMPPAIVARMATTIDSISGGRFGINLITGWQRPEYSQMGLWPGDDYFGDRYEYLGEYTSVLKELLTEGQS 160 Agrobacterium
WP_004930951  81 IKIYATAATLVMPPAIVARMASTIDSISNGRFGLNVVTGWQAPEYSQMGMWPGDEYFAKRYEYLSEYVQILRELWATGQS 160 Acinetobacter
WP_012752596  81 IKLYATAPTLCLPPAIVARMASTIDSISNGRFGLNLVTGWQRPEYAQMGLWPGDEYFGRRYEYLSEYAQVLRELWETGRS 160 Methylobacteriu...
WP_003956965 161 NVKGEFYRMDECVLSPRPAGgHIDILAAGQSGTGMRFAAEYADGNFILGSGVNTPLALSEAAAALAGQARRTGREVGTLA 240 Streptomyces cl...
WP_001619307 161 DFKGDFFTMNDCRVSPQPSV-PMKVICAGQSDAGMAFSARYADFNFCFGKGVNTPTAFAPTAARMKQAAEQTGRDVGSYV 239 Escherichia coli
WP_024640134 161 DFKGEHFSMQDCRVSPRPQA-DMKLICAGQSEAGMAFSAQYADYNFCFGKGVNTPTAFAPTAQKLLEANEKTGRNVTSCV 239 Pseudomonas syr...
WP_010920639 161 DFKGKYFTMDDCRVSPHPK--ETKLICAGSSDEGLAFTAQYADYSFALGKGTNTPTAFASVNRRLEAAAAKTGRDVQSFI 238 Caulobacter vib...
WP_006312122 161 DFKGKFFQMDDCRMKPVPQG-DVKLICAGSSNSGMAFSAKFADYSFCFGVGVNTPKAFAPTNERLLAATEKSGREVKSVV 239 Agrobacterium
WP_004930951 161 DFKGEHFQMEDCRVSPQPQA-EMKIICAGQSDTGLEFSAQHADYNFVFGKGLNTPTAYAGINDRLKHFTDQTGRDVQTYV 239 Acinetobacter
WP_012752596 161 DLKGEFFQMEDCRLSPRPQA-EMKIICAGQSTAGMEFTATYADYNFCFGKGVNTPTAFAPTVERLEEAKAKTGRDVSSYV 239 Methylobacteriu...
WP_003956965 241 LFMVIAEESDGAAQAKWKDYHDNADLSALGYMTAQTAKDKDADESSTAKTVALPEGAVNLNMGTLVGSYGTVARMLDQVS 320 Streptomyces cl...
WP_001619307 240 LFMVIADETDDAARAKWEHYKAGADEEALSWLTEQSQKDTRSGTDTNVRQMADPTSAVNINMGTLVGSYASVARMLDEVA 319 Escherichia coli
WP_024640134 240 LFMIIADDTDEAARARWEHIKDGADEEAIAWLSEKGSADKSAG--SNLRQMADPTSAVNINMGTLVGSWATVARMLDEVA 317 Pseudomonas syr...
WP_010920639 239 LFMVIADETDEKAMAKWQKYRDGADQEALAWLTQQAAPNAKAGATTNTQQLAAPESAVNLNMGTLVGSYESIARMMDEIA 318 Caulobacter vib...
WP_006312122 240 LTMVLAEEKSEDAWAKWEHYKAGADEDAIKWLGLQSAVDTKSGSDTNVRHMSNPVSAVNINMGTLIGSYEEVAAMLDEMS 319 Agrobacterium
WP_004930951 240 LFMVIAAETDAEAMAKWQSYNDGADVEAINWLMNQGGKDTKSGADTNIRQMASSVSPVNINMGTLVGSYEKVAAMLDEIA 319 Acinetobacter
WP_012752596 240 LFMVISDETDEAARAKWEHYKAGADAEAFAWLGLQGAADTKSGADTNIRQMADPTSAVNINMGTLVGSHATVAALLDEVV 319 Methylobacteriu...
WP_003956965 321 EVHGVKGVILVFDEFLEGVEKFGTRIQPLMTSRASV 356 Streptomyces clavuligerus
WP_001619307 320 SVPGAEGVLLTFDDFLSGIETFGERIQPLMQCRAHL 355 Escherichia coli
WP_024640134 318 SVPGTQGVMLTFDDFVKGVEDFGEKIQPLMTSRKHI 353 Pseudomonas syringae
WP_010920639 319 QVPGTAGVLLTFDDFVQGVEDFGTKIQPLMKSRKGG 354 Caulobacter vibrioides
WP_006312122 320 EVPGTGGVMLTFDDFLEGVEKFGKYVQPLMKSRQHV 355 Agrobacterium
WP_004930951 320 EIKGTEGILLTFDDFVQGVEDFGERIQPLMTSRQDI 355 Acinetobacter
WP_012752596 320 TVPGTGGVLLVFDDFLKGLDDFGTKIQPLMRSRRHV 355 Methylobacterium extorquens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap