Conserved Protein Domain Family
S_layer_CsaB

?
TIGR03609: S_layer_CsaB 
polysaccharide pyruvyl transferase CsaB
The CsaB protein (cell surface anchoring B) of Bacillus anthracis adds a pyruvoyl group to peptidoglycan-associated polysaccharide. This addition is required for proteins with an S-layer homology domain (pfam00395) to bind. Within the larger group of proteins described by pfam04230, this model represents a distinct clade that nearly exactly follows the phylogenetic distribution of the S-layer homology domain (pfam00395). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 132648
View PSSM: TIGR03609
Aligned: 23 rows
Threshold Bit Score: 266.05
Threshold Setting Gi: 499486021
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011195235   4 ILIAGYYGFHNAGDEAMLAG---LrraIREL-R-P-DVT-FTAISGTASQTRRLH-GIGAVSRSDIRGIWEAIGRADLVM 75  Symbiobacterium...
WP_001984129   3 LVLSGYYGFYNVGDEAILQS---IikaLHEE-D-P-TLE-LVVLSNDPDYTRKMY-GVEAVNRWDIRAIYKEIKRSNGLI 74  Bacillus cereus
WP_009610643   3 AVISGYYGFDNIGDEAVLKC---I---VYGL-K-QrGVEdITVLSNKPIETSRKY-KVKAANRNSLKEIFRAIKRADVVL 73  Caldanaerobacte...
WP_011391759   4 VVISGYYGFQNAGDEAVLYS---IvkaLRSL-E-P-DIE-ITVLSRRPEQTAACL-KVRAVDRWHPVRVAGAIRRADLVI 75  Moorella thermo...
WP_011130068  11 VLLCGYYGEHNLGDDALLQV---L---LEEL-P-S-SLQ-PWITANDSNVIKGLApKAQVINRRSLLESIRALFQVQGLI 80  Prochlorococcus...
WP_012543463   4 VLMVGYWGGFNVGDEGFLEI---V---LPRL-K-H-KAH-ITVASKNPENTTKSF-NVRSV-KAEPLTLVRELLRNDIVL 71  Coprothermobact...
WP_012547940   4 LLLFGYYGEGNLGDELLLRS---L---ISVF-R-K-NHK-VGILTNKVNKGQKD--DIVEFNKFSI-EILKGIRWTDVVI 70  Dictyoglomus th...
WP_015920317   4 AFLWGYYGFGNFGDEIMFRAcvdL---LKEL-D-F-GTI-YTPLPDGKRSM-----GVTSVGRFSP-KLISFLRRSQISM 70  Thermotoga neap...
WP_011529350   3 VAVSGYYGFGNTGDEAIALA---I---TRELkR-Q-GAV-PLLLSQTPAETARAY-GCESAARMNPAALLGALARSQVLL 72  Deinococcus geo...
WP_010886807   3 AVVSGYYGFGNTGDEAIALA---I---TREL-KkQ-GID-PVLLSNDPAESARLY-GCEAVARMQPLDVGRALLRADLLL 72  Deinococcus rad...
WP_011195235  76 FGGGSLLQDVTSSRSLIYYLGLATMARLRRKPVMFCAQGIGPVTRPLGRALVPLIVNRAALITA-RDAEAAE-TFRRLGV 153 Symbiobacterium...
WP_001984129  75 SGGGSLLQDKTSIKSILYYTGIMRIARFLKKPYYIYAQGIGPITKRQNRLLVKWQVSKAEYISV-RDEDSFL-YLKEIGI 152 Bacillus cereus
WP_009610643  74 SGGGSLIQDKTSSRSLWYYLGIMILGKLLRKKVYVVGQGIGPVEKKFDRWLASIVLNKVDGITV-RDQLSYEfLLKELGI 152 Caldanaerobacte...
WP_011391759  76 SGGGSLFQDVTGPKSLLYYLGIVLLARLLRKPVIVYAQGLGPLKRHWSRWLTGRVLNRVQLISL-RDSESRR-LLEELGV 153 Moorella thermo...
WP_011130068  81 LGGGSLLQDSTSFKSLIYYLILIVIAQQRGVPVLLWGQGLGPFRYRLSRWMVRRVLRRVQAISW-RDPDSFQ-LAEQWCL 158 Prochlorococcus...
WP_012543463  72 EGPGGLFQDATSFKSLFYYFLPPFLGKLFGKKVYLYGIGIGPINRSISERLTLKAFRMADGKYV-RDAYSYD-WLQSRGV 149 Coprothermobact...
WP_012547940  71 GGGGGIFQDKTSSKSFYYYLFIIFLSLLFKKKVYLIGQSFSPLKKRINGFLLRFFLNNVEKIYV-RDSFSKN-YLEKLGV 148 Dictyoglomus th...
WP_015920317  71 AGGGGLFQDVTSFRSILYYYYLSRMSLLMKKPLIFFGNSIGPLKRTASKRLVHEVVSHKSVVFIaREPVSYR-YVRALGG 149 Thermotoga neap...
WP_011529350  73 SGGGGLLQDKTSARTLQYYLGVIQLARRLGRRVVIFNQSIGPLSEAGGRRVAA-ALRGLRVI-V-RDRGSLD-TLRALGI 148 Deinococcus geo...
WP_010886807  73 SGGGGLLQDKTSSRTLTYYLGVIRMARLLRKPVFVFNQSVGPLSE-AGRRQVQRGLRGVQAV-V-RDRGSQE-LLGQLGV 148 Deinococcus rad...
WP_011195235 154 trpP--VTVTADAALVLGPA----D---P-----------AAGEALlrgagvdvSR-----PVIGVSVRPWKPGREPLEP 208 Symbiobacterium...
WP_001984129 153 ---KkdIELVPDPVLACQPEgmksE---W-----------LQKHSI--------QG-----KVIAVSVRYW-DAKEDYMK 201 Bacillus cereus
WP_009610643 153 ---KreVEIAADFAINFPLE----E---VddrvfekilekEGIDLL--------SQ-----EYLLICPREWGNFELSRVE 209 Caldanaerobacte...
WP_011391759 154 trpP--VYVTADPVLGLEPE----NmdlR-----------PGQDKW--------EQlelsgPVIGISVRSWPGY-EECWP 207 Moorella thermo...
WP_011130068 159 p-sP--MLMAPDPVWQLPSR----S---W-----------EGG------------------QAVVLCWRSTSMLDRFGWQ 199 Prochlorococcus...
WP_012543463 150 ---S--CDLAADVVFTVAGE----H---Y-----------YGYNPM--------FD-----SVLYIPSHKWENLDVDQVD 193 Coprothermobact...
WP_012547940 149 rsdK--IILSTDLAFLLDIP----F----------------PSREE--------DK-----KILGINLRKWGNLN---LE 190 Dictyoglomus th...
WP_015920317 150 ---N--AWLGTDPSILYLMN----D----------------ESEVK--------KE-----NKAVFFLKK--PLDVSCVL 189 Thermotoga neap...
WP_011529350 149 ---E--GELGGDPALLLSPT----P---G-----------LDQ-----------DT-----QRVIVAPR----GDVTDAT 185 Deinococcus geo...
WP_010886807 149 ---P--ARLGGDPALLLRPS---------------------AGLER--------DM-----STVVIAPR----GDVTETL 185 Deinococcus rad...
WP_011195235 209 RLAEALDRLAGETGAQVVFIPMQQVKDVEASRAVVACMRAPAVVLnG------PYTYEDLRAVIARCDLLIGMRYHSLVF 282 Symbiobacterium...
WP_001984129 202 KLADTLKQLKRD-GYHILFVPMHGPFDQNASRDIINLMGEEAHMLpY------KLDIHEKISILSECSLLIGMRLHALIL 274 Bacillus cereus
WP_009610643 210 -LARAADFISEEYGYRIVFLPFY-HEDIEESDRIATYMKMPSDILtE------KYDVEEILAIIKRSEFLIGIRLHSLIF 281 Caldanaerobacte...
WP_011391759 208 SLARVADELVAG-GWQVLFLPFHFPADVDACRQVARLMHSPAVVLrE------NLDLPALMGLMGRLQFLIGMRLHALIL 280 Moorella thermo...
WP_011130068 200 HLLQALEMILTDIDAPVHWLAFHQRQDEELFRKLDRQGLISSSLR-SrshsfaFDSLTEVMNQFTMARLVLPMRLHALIL 278 Prochlorococcus...
WP_012543463 194 -------------GNMVIFFP---GKDLPMTAAARGTYIDG-----L------ELGVLEIVSLFKQYKGAVVGRLHAGIL 246 Coprothermobact...
WP_012547940 191 NLNSTLETLISKYDSFY-FFSFQQ-EDSQFYEILKDKFKKIDLI--E------PQDP-NFYDYYSSCRLFIGMRLHSCIL 259 Dictyoglomus th...
WP_015920317 190 KSLR-----EHGIEDFVLSSAF--SKDCQYLPPLRTGG--------------------DVLEEIKSSSIVITERFHPALV 242 Thermotoga neap...
WP_011529350 186 ERLKTVTAHLRAQGRRVTALALMPEQDDPAARSL-----GADEVL-S------TRDPQAALDAIAAAGFVVGVRLHAVIL 253 Deinococcus geo...
WP_010886807 186 APLREVTALLRSRGRRVIALSFMPEQDDEAARSL-----GAAEVL-S------TRDPQLALDTIARSGFVIGVRLHALIL 253 Deinococcus rad...
WP_011195235 283 AAMSGVPLVGISYDPKNDAFLRQ----IGHEAAGSTGG 316 Symbiobacterium thermophilum
WP_001984129 275 SAVANIPMVGISYDPKIDSFLQQ----VNQPIIGNVDG 308 Bacillus cereus
WP_009610643 282 AFISLVPFVGISYDPKIDGFLHS----IGEKSVGDVNS 315 Caldanaerobacter subterraneus
WP_011391759 281 ASLMGVPFLALPYDPKVTALARM----MEQPVAGFLAS 314 Moorella thermoacetica
WP_011130068 279 AQLAGSPTVALSYDPKVSSAALM----ANVPFTDLQSL 312 Prochlorococcus marinus
WP_012543463 247 ATIAGLPFVAIPYDVKLTEYARElaatLGVPQDALLAK 284 Coprothermobacter proteolyticus
WP_012547940 260 SVLSGIPFIAISYDEKVEAFCHD----IGWKFIIKDFS 293 Dictyoglomus thermophilum
WP_015920317 243 AAYFEVPFVIVDCQKARRFFRKY----TEEEFFFSRRD 276 Thermotoga neapolitana
WP_011529350 254 AAAAGVPFAGVSYDPKVQGFCAD----AGAPACPTAFD 287 Deinococcus geothermalis
WP_010886807 254 AAAAEVPFAGVAYDPKVQGFCDD----AGAPVFPVPPD 287 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap