Conserved Protein Domain Family
Pse_Me-ase

?
TIGR03587: Pse_Me-ase 
pseudaminic acid biosynthesis-associated methylase
Members of this small clade are methyltransferases of the pfam08241 family and are observed within operons for the biosynthesis of pseudaminic acid, a component of exopolysaccharide and flagellin glycosyl modifications. Notable among these genomes is Pseudomonas fluorescens PfO-1. Possibly one of the two hydroxyl groups of pseudaminic acid, at positions 4 and 8 is converted to a methoxy group by this enzyme
Statistics
?
PSSM-Id: 132626
View PSSM: TIGR03587
Aligned: 4 rows
Threshold Bit Score: 334.462
Threshold Setting Gi: 499905388
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011450033   4 YKTDQEKFWAGEFGTEYISRNANRDSI----------SKNLAFFAAALKHTRNINSCIEFGANIGINLKALKILLPKLNQ 73  Methanospirillu...
WP_011313972   3 QITEQEQFWAGEFGDNYIDRNKSQELV----------AAKIAMFSRVVQRCSQIRSARELGANIGLNILALKSLLPHAAF 72  Nitrobacter win...
WP_011333034   3 DLSEQEQFWQGEFGNQYVDRNVGQPLV----------AANLALFAKALTRAGRIDSLLELGTNAGNNLQALRQLLPRCEL 72  Pseudomonas flu...
WP_011586122   1 MKTKQEQFWGGEFGKEYTDRNSRESAEwdkfyienwgISKVEMNDRFLNALPKDASILEVGCNTGMQLAGLQRS-GFKHI 79  Cytophaga hutch...
WP_011450033  74 YAIEINTDAITELNKfLPEQNIFPQSILE-YSPTKTFDLVLIKGVLIHINPEYLEKVYNLLYESSNRYLLICEYYNPSPI 152 Methanospirillu...
WP_011313972  73 QAIEINSRAFERLAT-IPGIAASNTTLFE-PVEWPGVDLAFTVGVLIHLNPDMLPVAYERLYQASNRYVLTAEYYNPSVV 150 Nitrobacter win...
WP_011333034  73 FGVEINASACAQARA-LEIANIWHGSLFD-FPRERQYDLTLSKGVLIHLAPELLATAYAQLYALSSRYILIAEYYNPSPV 150 Pseudomonas flu...
WP_011586122  80 YGVELQEYAVEKAKAyTKNINVIQGSGFDiPFKDNFFDVVCTNGVLIHISPDNLPTMMREMVRCSKKYIWGWEYYAEETT 159 Cytophaga hutch...
WP_011450033 153 EVTYRGHQKRLFKRDFCGEMLDLYEDLILTDYG-FVYHRDWNFPQDDINWFLLEKK 207 Methanospirillum hungatei
WP_011313972 151 EISYRGHSGRLWKRDFAGEMMDRFPDLKLVDYG-FIYHRDPVFPADDITWFLMEKR 205 Nitrobacter winogradskyi
WP_011333034 151 EVSYRGNSGKLFKRDFAGEMLDRYPDLQLLDYG-FGYHRDPQFPVDDITWFLLEKR 205 Pseudomonas fluorescens
WP_011586122 160 TINYRGNTDYLWKADYADLFMKYCPNLKLVKKElFPYVSQAESGNKDC-MYLLEKI 214 Cytophaga hutchinsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap