Conserved Protein Domain Family
PseI

?
TIGR03586: PseI 
pseudaminic acid synthase
Members of this family are included within the larger pfam03102 (NeuB) family. NeuB itself (TIGR03569) is involved in the biosynthesis of neuraminic acid by the condensation of phosphoenolpyruvate (PEP) with N-Acetyl-D-Mannosamine. In an analagous reaction, this enzyme, PseI, condenses PEP with 6-deoxy-beta-L-AltNAc4NAc to generate pseudaminic acid.
Statistics
?
PSSM-Id: 163337
View PSSM: TIGR03586
Aligned: 15 rows
Threshold Bit Score: 533.807
Threshold Setting Gi: 488959209
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KGI59092       6 TPLIIAELSANHNQSLEIAKDSIRAIAACGADGVKLQTYTPECLTLQSNEPHFCI-S-GGtLWDKRN-LYELYKEAQTPW 82  Helicobacter sp...
WP_011287012  15 PPFIIAELSANHNGSLERALQTIDAAKACGADAIKLQTYTADTMTIDCDQPEFMI-R-GG-LWDGYK-LYDLYQWAQTPF 90  Dechloromonas a...
WP_011219362  16 PPYIIAELSANHNGDINRAFKIMEEAKKAGADAIKLQTYTHETITIDCDSEDFQI-H-GG-LWDGQT-LYELYKGAHMPW 91  Photobacterium ...
WP_011139889   5 dlLLIAELSANHNQEKNLALETLHAAKESGANAVKLQTYTADTLTLDSSKPYFQI-QsDT-LWDGET-LYSLYQKAYTPW 81  Wolinella succi...
WP_010920708  24 SPYVICELSGNHNGSLERCLAMVDAAADTGCDAIKIQTYTADTITLDVDRPEFKI-H-GG-LWDGRT-LYELYEEAHTPF 99  Caulobacter vib...
WP_011497536  18 QPYIIAELSGNHKGSLSQALAMIDAAAASGVDAIKIQTYTANTITLQHDGPEFRI-N-GG-LWKGRT-LFDLYEEAHTPW 93  Shewanella deni...
WP_011495734  14 PTYIIAELSANHGGSLEQAKIMIQKAKQAGADAVKIQTYRADTITLNCDKADFRLpS-GN-AWEAHNtLYALYQEAYTPW 91  Shewanella deni...
WP_011383156  16 PPFIIAEMSANHNGDLGRALALLEAAAAAGADAVKLQTLKPDAITIDCDRPDFVI-E-GG-PWGGRK-LYDLYAEAQTPW 91  Magnetospirillu...
WP_011577316   4 YPKIVAELSANHNQDLNLAKESLHAIKESGADFVKLQTYTPSCMTLNSKEDPFII-Q-GT-LWDKEN-LYALYQKASTPL 79  Helicobacter ac...
WP_015902402  11 KVFIIAELSANHAGSLKTAKDTVYAAKESGADAIKLQTYTPEWMTLKIDRDEFK--A-GD-LWKDEY-LYDLYQKAMTPL 85  Nautilia profun...
KGI59092      83 EWHKELFSLAKELGLLIFSSPFSPKGVAFLESLQCPIYKVASFEVMHYELIEAIAKTKKPIIISTGVATHKELKTALEIC 162 Helicobacter sp...
WP_011287012  91 DWHKAMFEHARKIGITVFSTPFDESAVDLLEALDTPAYKIASFELTDLPLIRYVAATGKPMIMSTGMASEAEIEEAVSAA 170 Dechloromonas a...
WP_011219362  92 EWHQTLFEKAKELDITIFSSPFDFTAVDLLEELNAPAYKIASFELVDLPLIARVAKTGKPMIMSTGMANKEEIAEAIKTA 171 Photobacterium ...
WP_011139889  82 EWHEELFEYAKKLGLLCFSTPFDPTAVDFLETLGNPIYKIASFEINDIPLIRYAARLQKPMILSTGIASLEEISEAVEAC 161 Wolinella succi...
WP_010920708 100 EWHAAIFERARQRGVTIFSSPFDETAVDLLDSLGAPAFKIASFEAVDLPLIKYAAAKGKPLIISTGMANLTEMQTALDTA 179 Caulobacter vib...
WP_011497536  94 EWHKSLFEHAKKQNVTLFSSPFDLKAIELLESCECPAYKISSFEINDIGLIMAAAKTGKPIVMSTGLATLAEIEEAVEAV 173 Shewanella deni...
WP_011495734  92 EWNKALFEEARRIGITLFSSPFDETAVDLLESLNAPAYKIASPEITDIGLLKYVARTGKPIILSTGIADLADIELAVETL 171 Shewanella deni...
WP_011383156  92 DWHAKLFERGRELGLIVFSSPFDKAAVDFLAGLDAPAFKIASFEMADPGLVAHAAAKGKPIIVSTGMAGLGDIAATVETV 171 Magnetospirillu...
WP_011577316  80 EWHAELFELAKKLDLGIFSSPFSSQALELLESLDCPMYKIASFEIVDLDLIEKVAHTKKPIILSSGIATHTELQDAINLC 159 Helicobacter ac...
WP_015902402  86 EWHKELFDYARSLELEVFSSPFSKEAVDFLEQFEPPAYKIASFEITDYDLIDYAASKGRPMIISTGVATLQEIQDVADIC 165 Nautilia profun...
KGI59092     163 HKYGCKDITLLHCISEYPAPLESANLLAMPQLAktyKKYNIKYGLSDHTLGALCPSIATSLGASMIEKHFILDSSLGGVD 242 Helicobacter sp...
WP_011287012 171 REAGCTDLVLLHCISSYPAPMDQAKLRQIAGLE---SRFGVTPGLSDHTLGTVASVAGVALGACVIEKHFTLSRADKGPD 247 Dechloromonas a...
WP_011219362 172 QENGCKELVVLHCVSGYPAPADQYNLRTISDIA---SRFNVLSGLSDHTIDNATAVASVALGACLIEKHVTLDRSGGGAD 248 Photobacterium ...
WP_011139889 162 RNEGNEDITLLACTSSYPAPLEEANLARIPDLK---RRFGVKVGLSDHTLGLIAPIVAVSLGASVIEKHFILSRSLGGPD 238 Wolinella succi...
WP_010920708 180 LSAGAPGVLLLHCVSSYPATFADANVRTVPDMA---ARFGCPIGLSDHTPGTAASVAAVSLGACAVEKHFTLARADGGPD 256 Caulobacter vib...
WP_011497536 174 ANAGGTQLALLHCISGYPTPIEDCNLKTVADLC---QRFNFPIGLSDHTTDILASVTSVALGASIIEKHFTLDKTDGGVD 250 Shewanella deni...
WP_011495734 172 RANGCEALAILKCTTAYPTPYSECNLRTIADIG---KRFSCVAGLSDHTLGLASPIAATALGGKIIEKHFILDKTDNSVD 248 Shewanella deni...
WP_011383156 172 RRAGNDQLVLLHCISSYPAPTEEANLATIPHMA---QAFGVPVGLSDHTQGTAVAVTAVALGACVVEKHFTLRRADGGLD 248 Magnetospirillu...
WP_011577316 160 KEVNNFDITLLKCVSAYPSQLEDANLLSMVKLG---EKFGVKFGLSDHTIGSLCPILATTLGASMIEKHFILNKSLQTLD 236 Helicobacter ac...
WP_015902402 166 KKRGV-ELALLKCTSAYPTPRSEVNLKTIPAIK---EIFNVEVGFSDHTLGISAPVAAAAMGARIIEKHFILDKNLNSPD 241 Nautilia profun...
KGI59092     243 SAFSMNKDEFKAMVEQVRDTALALGCKKPKISADIrKKRRQFARSIWVSADIKKGEKFTHKNLSVVRPSGGEHPRYLHKI 322 Helicobacter sp...
WP_011287012 248 SEFSLEPDELRRLCQDARDAWSALGSLGFERQQAE-EASKVFRRSVYFVRDVSAGTVIGAEHIRRIRPGMGLEPKYFDQL 326 Dechloromonas a...
WP_011219362 249 DSFSLEPIELAQLCKDAKTAWQSLGKVNYERTEAE-KGNVKFRRSLYVVKDIAEGEEFTSENVKSIRPGFGLPPKNLINI 327 Photobacterium ...
WP_011139889 239 GAFSLEPSEFKEMVSSIHAASLALGEANYELSPKV-AKSKIFKRSLFVCEKIQKGERFTPKNLRSIRPGHGLPPKHLNEI 317 Wolinella succi...
WP_010920708 257 AAFSLEPAEFKALVDDTKNAWAALGRAHYDVLGSE-ATSLLFRRSLYVTADVKAGEPLTRANVRSVRPGNGLPPADLDKV 335 Caulobacter vib...
WP_011497536 251 AAFSLEPDEFGLLKKETQRAHSALGYAGYDIKPSE-AGGRDFRRSVYVADDIRKGELFTASNVRSVRPGLGLHTRYLPQI 329 Shewanella deni...
WP_011495734 249 AFFSLDEHEFSQMVTEVRNAELALGTISYEISGSA-NKNKLARRSLYYSQAIKAGEVITNENVKSVRPGFGLHPKHFDAI 327 Shewanella deni...
WP_011383156 249 SHFSLEPEELAQLVKDCRTAWVARGRISYALAECE-QGSKAFRRSLYVVEDLHPGEIITEDKVRSIRPGYGLEPKFLPEI 327 Magnetospirillu...
WP_011577316 237 SAFSMDFNEFKNMVKTIKQSVLALGEEEPKINPKTlEKQRFFARSLFVIKDIQKGETLTSDNIKALRPNLGLHPKFYKEI 316 Helicobacter ac...
WP_015902402 242 KDFSLTPDEFKEMVMAVRETEEMMGEVNFKP-----KSGRQFARSLYVVKDIEKGETFSEENIKSIRPGYGLHPKYLPEI 316 Nautilia profun...
KGI59092     323 LGKSAKVALKAAQPL 337 Helicobacter sp. MIT 03-1614
WP_011287012 327 IGRRVNQDVSRGTPV 341 Dechloromonas aromatica
WP_011219362 328 LGKRANMKIKFGTPL 342 Photobacterium profundum
WP_011139889 318 LGKEAACDIERGEPL 332 Wolinella succinogenes
WP_010920708 336 LAGKATRDLARGEPL 350 Caulobacter vibrioides
WP_011497536 330 IGQKSSQDIAFGSPM 344 Shewanella denitrificans
WP_011495734 328 LGLRLKHDVEFGDRV 342 Shewanella denitrificans
WP_011383156 328 LGRKARKAVPRGTAF 342 Magnetospirillum magneticum
WP_011577316 317 LGQRASKFLKANTPL 331 Helicobacter acinonychis
WP_015902402 317 LGKKACKDLKKGDRL 331 Nautilia profundicola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap