2ICS


Conserved Protein Domain Family
EF_0837

?
TIGR03583: EF_0837 
Click on image for an interactive view with Cn3D
probable amidohydrolase EF_0837/AHA_3915
Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. These proteins resemble aminohydrolases (see pfam01979), including dihydroorotases. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 132622
View PSSM: TIGR03583
Aligned: 8 rows
Threshold Bit Score: 615.567
Threshold Setting Gi: 497578104
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ICS_A         5 YDLLIKNGQTVNGXPVEIAIKEKKIAAVAaTISGS---A-KETIHLEPGTYVSAGWIDDHVHCFEKXALYYDYPDEIGVK 80  Enterococcus fa...
WP_000459938   2 FDLLLRHARLVDDTLTNIALQDGKIAALG-DVDGP---A-LKTIDLRGECYVSAGWIDSHVHCYPKSPIYHDEPDSVGIA 76  Salmonella ente...
WP_011707607   2 YDIIIRAGRQGDGQLVDIAIMEGKIAAIGtLPETA---AaQQTLDLGGRVHVSAGWIDGHTHCYPASPIYHDEPDKVGVE 78  Aeromonas hydro...
WP_011100936   2 TELYIHNGRDVSGAPVAVLITDGVIAEVGtELTVPv--G-CPTLDAQG-CYITAGWIDDHTHCNAHAALYYDDADAIGYR 77  Lactobacillus p...
WP_011067601   1 mvqIVKNATLVNGTTVDIVIENQRIVEASeTTTIQ---G-DVIVDAAG-MYVSPGWIDLHTHAFPKYKPYCAMPDQIGYK 75  Oceanobacillus ...
WP_000139959   3 ERFVLRNVKRVNGEEIDIVIENNKIAQVTkAGAGE---G-GKVLDYSG-TYVSSGWIDLHVHAFPEFDPYGDEVDEIGVK 77  Bacillus anthracis
WP_009892288   3 IDILIKCGKTVDKSIIDIAILDDKIIEVKnHIDDSkyqA-KQIINLDGEKFISAGWIDIHTHCYERLDLYKDYPDEVGIK 81  [Clostridium] d...
WP_010774176   3 YDLLIKNGQTVNGMPVEIAIKEKKIAAVAaTISGS---A-KETIHLEPGTYVSAGWIDDHVHCFEKMALYYDYPDEIGVK 78  Enterococcus fa...
2ICS_A        81 KGVTTVIDAGTTGAENIHEFYDLAQQAKTNVFGLVNISKWGIVAQDELADLSKVQASLVKKAIQELPDFVVGIXARXSRT 160 Enterococcus fa...
WP_000459938  77 TGVTTVVDAGSTGADDIDDFYTLTRDAATEVYALLNVSRVGLIAQNELANMANIDADAVRQAVKRHPDFIVGLKARMSSS 156 Salmonella ente...
WP_011707607  79 SGVTTVIDAGSTGADDVDDFQRLAAGCKTRVHALLNISRIGLLRQNELADSRDLDMDLASAAIRRHPGFIVGIKARMSGS 158 Aeromonas hydro...
WP_011100936  78 TGVTTVIDAGSTGADNVADLYQQAHRAATNVYALLNIARTGIVAQDELADLNQLSFSALRTAIKRYPDFIVGLKVRVSKS 157 Lactobacillus p...
WP_011067601  76 TGVTTVVDAGSSGADDVDEFYRIAQEATTRVFAFLNISRIGLMRQDELSDLDNLSFAAIQQAVEEYPQFIVGLKARMSAS 155 Oceanobacillus ...
WP_000139959  78 QGVTTIVDAGSCGADRIADLVKSREQAKTNLFAFLNISRIGLKRIDELSNMEWIDKEKVIQAVEKYKDVIVGLKARMSKS 157 Bacillus anthracis
WP_009892288  82 SGVTTVVDAGTTGALDIGEFYEDTKKYKTNVYALINIAKQGITSQDELSNMMNIDEYELKNAVRKYKDFVVGIKARMSKS 161 [Clostridium] d...
WP_010774176  79 KGVTTVIDAGTTGAENIHEFYDLAQQAKTNVFGLVNISKWGIVAQDELADLSKVQASLVKKAIQELPDFVVGIKARMSRT 158 Enterococcus fa...
2ICS_A       161 VIGDNGITPLELAKQIQQE-NQEIPLXVHIGSAPPHLDEILALXEKGDVLTHCFNGKENG-ILDqATDKIKDFAWQAYNK 238 Enterococcus fa...
WP_000459938 157 VVGVNGITPLERAKAMQQE-NGNLPLMVHIGNNPPDLDEIAERLTAGDIITHCYNGKPNR-ILR-PDGELRASVTRALAR 233 Salmonella ente...
WP_011707607 159 VVGENGLQPLRMAKTLQQA-HGRLPLMVHVGNTPPDLDEIVALLGDGDLLTHCFNGKPNR-ILT-PAGELRQAVREAMQR 235 Aeromonas hydro...
WP_011100936 158 VVGDNGVEPLRVAKQYQADlTVQLPLMVHIGSNPPELAAIIALMRPGDVLTHCFNGKPNG-IVN-STGEVAQYVRKAYQK 235 Lactobacillus p...
WP_011067601 156 VVCGNGIQPLSIAETFRHK--LELPLMVHVGTAPPELNEVLSYMKKGDILTHCYHEKENNhIFR-EDGSVEPSLLAAIDR 232 Oceanobacillus ...
WP_000139959 158 VVCDSGIEPLHIARDLSRE-T-SLPIMVHIGSAPPRIEEVVPLLEKDDVITHYLNGKENN-LFD-EEGKPLPVLLDAVNR 233 Bacillus anthracis
WP_009892288 162 VVISNDVEPLKVAKRIKNE--LNLPMMVHFGSSPPTIEDIFDYMEKGDILTHIYNGKPNG-ILR--GNEVKKEIIEAKER 236 [Clostridium] d...
WP_010774176 159 VIGDNGITPLELAKQIQQE-NQEIPLMVHIGSAPPHLDEILALMEKGDVLTHCFNGKENG-ILDqATDKIKDFAWQAYNK 236 Enterococcus fa...
2ICS_A       239 GVVFDIGHGTDSFNFHVAETALREGXKAASISTDIYIRNRENGPVYDLATTXEKLRVVGYDWPEIIEKVTKAPAENFHLT 318 Enterococcus fa...
WP_000459938 234 GVRLDVGHGTASLSFAVAKRAISLGILPHTISSDIYCRNRINGPVHSLANVMSKFLAIGMSLPQVIACVTANAADSLNLK 313 Salmonella ente...
WP_011707607 236 GLLLDIGHGGASFSFEVAELAIAQGILPRTISSDIYCKNRIKGPVYSLAHVMSKFLAIGMTLEQVLACVTHHAADALRLS 315 Aeromonas hydro...
WP_011100936 236 GLIFDVGHGTDSFSFRTAALARTAHLFPQTLSSDIYYRNRLNGPVYSLAVCVEKLLLLGYRLEEIIPMITTNPARIFKLT 315 Lactobacillus p...
WP_011067601 233 GVYLDVGHGSSSFSFGIAQKAKQQGVYFDSLGTDIYQNNQKNGPVYNMETMLSKFLALGYSLEEVIEAVTIKPAEILRKP 312 Oceanobacillus ...
WP_000139959 234 GVHLDVGHGNASFSFKVAEAAKRHDIAFHTISTDIYRKNRVHGPVYSMAHVLSKFLYLGYPLEEVIDAVTKHAAEWLKKP 313 Bacillus anthracis
WP_009892288 237 GIILDVGHGTESFSMDIAMKSKDAGIFPDTISTDIYIKNRINGPVYNLSTTMEKFIYMGYSLEDIIDKVTKNAADAISLK 316 [Clostridium] d...
WP_010774176 237 GVVFDIGHGTDSFNFHVAETALREGMKAASISTDIYIRNRENGPVYDLATTMEKLRVVGYDWPEIIEKVTKAPAENFHLT 316 Enterococcus fa...
2ICS_A       319 QKGTLEIGKDADLTIFTIQAEEKTLTDSNGLTRVAKEQIRPIKTIIGGQIYD 370 Enterococcus faecalis
WP_000459938 314 TKGRLQPGLDADLTLFTLKRQPTVLVDAENDSLQAEELLTPLAAIRAGKGYM 365 Salmonella enterica
WP_011707607 316 GKGRLEVGAAADLTLFEVSSGPTLFTDTEAGARNGDRQLLPLAALVGGELVL 367 Aeromonas hydrophila
WP_011100936 316 HKGQLCRGYDADLTIFQTVTAPQIVVDSTGEERIAPTQVIPTYSVIAGRVYT 367 Lactobacillus plantarum
WP_011067601 313 DLGSLQPGSIADLTFFTVKESSKKLTDSFGTSIDGELLIKAEAVIIGGKYFE 364 Oceanobacillus iheyensis
WP_000139959 314 ELGRIQEGDIANLTLFTVKDEKVKLIDSEGDQRIAERRIDTKGVVVNGSFIE 365 Bacillus anthracis
WP_009892288 317 NKGLIKEGYDADLTIFDVVNEEKELQDSLNKSVITSTSIKPRAVVVNGEYLN 368 [Clostridium] difficile
WP_010774176 317 QKGTLEIGKDADLTIFTIQAEEKTLTDSNGLTRVAKEQIRPIKTIIGGQIYD 368 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap