Conserved Protein Domain Family

TIGR03582: EF_0829 
PRD domain protein EF_0829/AHA_3910
Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. This protein contains a PRD domain (see pfam00874). The function is unknown. [Unknown function, General]
PSSM-Id: 132621
Aligned: 6 rows
Threshold Bit Score: 158.412
Threshold Setting Gi: 498392954
Created: 9-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011707602  82 LAEQVVAWLDKLAYEEAHLLSVHFEVAKEN 111 Aeromonas hydrophila
WP_001663336  79 LAREIVAAFGNLPDEEAWLLSVHFEVAKDN 108 Salmonella enterica
WP_002291790  81 ISDEIVRSIGNLTDDEIYVLSIHFETAKNN 110 Enterococcus faecium
WP_011246254  79 MAEKVCNRLTDLHEDEKYLLSIHFETAKMK 108 Bacillus clausii
WP_011262859  78 LAEDVVKWFPALAYEETYLLSVHFEVAKEN 107 Aliivibrio fischeri
WP_010706695  81 IAEETTEAIGQLSEDEWYVLAVHFEVAKQN 110 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap