Conserved Protein Domain Family
EF_0833

?
TIGR03579: EF_0833 
conserved hypothetical protein EF_0833/AHA_3914
Members of this family of relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown.
Statistics
?
PSSM-Id: 132618
View PSSM: TIGR03579
Aligned: 4 rows
Threshold Bit Score: 259.353
Threshold Setting Gi: 619194027
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KAJ69335      23 KSFWYADWGFPILVGIMSAAIFAGTHMYVVYGVGAFNEVSIVAMLKAGLDGGSYGAAAAFGASFLFARILEGSLVGILDL 102 Enterococcus fa...
WP_005421479   7 NNFWYADWSFPFFVGLLSSGVFAGTHMYYLYGIGAFNEVAFVSMLRAGMDTGVYGAVAAFGASFLFARIIEGSLVGILDI 86  Aliivibrio fisc...
WP_005355144   7 NNFWYADWSFPIFVGLLSAGVFAGTHMFYLYGVGAFNEVAFVAMLKAGMDTGAYGAVAAFGASFLFARIIEGSLVGILDI 86  Aeromonas
WP_011246258  15 KTFWYADWSFPIFVALLSSGIFAGTHMYYVYKIGAFNDVAIVAMLEAGIQGAGYGAAAAFGASFLFARVLEGALVGILDI 94  Bacillus clausii
KAJ69335     103 GGSILTGIGIGVPAIFLSMGIKAPVENFGLALLTGALLGLAVGGVIVLIRKFTINQGNSTFGADVMMGAGNASGRFLGPL 182 Enterococcus fa...
WP_005421479  87 GGAIQTGIGLGVPALLLGAGIVYPLENFVASLIVGFFLGVAIGYIIIIARKYTVGQSNSTYGADVMMGAGNSSGRFLGPL 166 Aliivibrio fisc...
WP_005355144  87 GGAIQTGVGLGVPALLLGAGIVYPVENFGASLATGMGIGLAIGYVIILARKFTINQSNSTYGADVMMGAGNSSGRFLGPL 166 Aeromonas
WP_011246258  95 GGSLQTGLGIGVPAILLASGITAPIENFILSLLTGAVLGALVGYAILAIRKLTVGQSNSTFGADIMMGAGNTSGRFLGPL 174 Bacillus clausii
KAJ69335     183 IILSAAGASIPIGIGATLGALGFYIWKKPIAGGAILGAMIFGAIFPVSL 231 Enterococcus faecalis MTmid8
WP_005421479 167 IVLSAIGASIPIGIGSLIGALAFYQWQKPITGGAILGAMIFGSLFPVAI 215 Aliivibrio fischeri
WP_005355144 167 IILSAMGASIPIGIGSLLGALLFYVWGKPITGGAILGAMLLGTFFPVAL 215 Aeromonas
WP_011246258 175 IVLSAASASIPIGIGSTIGAAIFYIWKKPVAGGAILGAMIFGAIFPISL 223 Bacillus clausii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap