Conserved Protein Domain Family
EF_0830

?
TIGR03577: EF_0830 
conserved hypothetical protein EF_0830/AHA_3911
Members of this family of small (about 120 amino acid), relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 132616
View PSSM: TIGR03577
Aligned: 5 rows
Threshold Bit Score: 183.101
Threshold Setting Gi: 499565472
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_016626764   2 ITVVIADRLGKGQNVAKGVEQAGGRAVVVPGMGADMRLGDVMQQEKADLGISFCGSGGAGALTAATKYGYPERHGMRSIE 81  Enterococcus fa...
WP_005421476   4 VKVVIGDRLGKGQKVGMGVEAAGGSVTVIPGMAADMKLGDIMKQEEADFGISFCGSGGAGAITAQNKYGYKAKYGMRSVE 83  Aliivibrio fisc...
WP_023248631   4 ITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGVAADMKLGDVMKAENATFGISFCGSGGAGAITAQNKHGYKAKYGMRSVD 83  Salmonella ente...
WP_017409377   4 IKLVIGDRLGKGQKVGAGAETAGASVTIIPGMAADMKLGDVMNKEQADLGISFCGSGGAGAITAQTKYGYKCRYGMRSIE 83  Aeromonas hydro...
WP_011246255  10 VVVVIGDRLGKGHHVAKGVEAAGGKAIVISGVGADMRLGDVMDTENADIGISFCGSGGAGAITAQTKYGYPAHYGMRSVD 89  Bacillus clausii
WP_016626764  82 EGVTAINDGKTVLGFGFMDQEELGKRVTEAFIKKH 116 Enterococcus faecalis
WP_005421476  84 EGVTAINEGYNVLGFGFMDQEELGKKLVEAFVKKY 118 Aliivibrio fischeri
WP_023248631  84 EGVTAINEGCNVLGFGFMDKEELGERLVQAWQKKY 118 Salmonella enterica
WP_017409377  84 EGVTAINEGCVVLGFGFMDKEELGQKLIEAFAKKH 118 Aeromonas hydrophila
WP_011246255  90 EGITAINEGKKVLGFGFMDTEELGKRITEAYLKKV 124 Bacillus clausii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap